SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3W4W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3W4W8
Domain Number 1 Region: 85-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000177
Family EGF-type module 0.009
Further Details:      
 
Domain Number 2 Region: 55-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000297
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 129-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000612
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 4 Region: 5-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000021
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3W4W8
Sequence length 281
Comment (tr|G3W4W8|G3W4W8_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000010473} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MLNISLDLQLCAAKSCHKNGTCTGSEESGSRCSCAPGSSGRNCRFKEGPCVINGSPCQNG
GACIDENGLASYTSCLCPEGFSGNFCELDMNSCVPNPCENGGVCTDIGGDFRCRCPLGFM
DKTCSQHVVDHCASGPCEHGGTCVPHARGGFECLCRPEFSGPTCNHGHPNHSHPGTKTKR
GPGLPDQFSPETQGRLAAHQPNHRMLKITMRELTKNSKPLLNESQAICFTILGVLTCLVV
LGTISIVFFNKCEIWLSNAKYSRLLRKKKNSLLRSPIKMSG
Download sequence
Identical sequences G3W4W8
ENSSHAP00000010473 ENSSHAP00000010473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]