SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3W813 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3W813
Domain Number 1 Region: 93-176
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000439
Family PDZ domain 0.078
Further Details:      
 
Domain Number 2 Region: 15-72
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000493
Family HtrA-like serine proteases 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3W813
Sequence length 333
Comment (tr|G3W813|G3W813_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000011568} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
LGGGGGETRRGRSECWEVFSVQENSPAQQAGLEPFFDFIITIGHARLNKESSTLKDLLKA
NMEKPVKLEVYSIKTLRVREVEVVPSNMWGGQGLLGASVRFCSFQRANEHVWHVLDVEPS
SPAALAGLQPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSETDLCREVVVTPN
SAWGGEGSLGCGIGYGYLHRIPTVSPKKPQETGLPAALPPETLSSSPVQGGYTEASLQAP
DSPFDGAPDVLDVDRSAASGSDACPVGTSLQPPPPVQRVMDPGFLDVSGIALLDTTDIAP
LPSTASSVSLPSLGESVMGTESVLPSREPLANN
Download sequence
Identical sequences G3W813
ENSSHAP00000011568 ENSSHAP00000011568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]