SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3W9D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3W9D2
Domain Number 1 Region: 74-175
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.65e-34
Family MBT repeat 0.00000366
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.5e-30
Family MBT repeat 0.0000329
Further Details:      
 
Domain Number 3 Region: 585-659
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.54e-19
Family SAM (sterile alpha motif) domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3W9D2
Sequence length 661
Comment (tr|G3W9D2|G3W9D2_SARHA) Scm polycomb group protein like 2 {ECO:0000313|Ensembl:ENSSHAP00000012037} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=SCML2 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MKLEARDPRNVTSVCIATVIGITGARLRLRLDGSDNKNDFWRLVDSSDIQPIGTCEKKGG
MLQPPLGFQMNASSWPMFLLRTLNGAEMAPAAFFKKEPPKPAPNLLKTGMKLEAIDKKNP
YLICPATVGDVKGDDVFITFDGWRGAFDYWCRYDSRDIFPVGWCGLTGDALQPPGNNVSI
TKSSAKTQSSPSKVTRRSMQSPQKTAPISAQRGKKPGRAKPPGQTSVPKKGRSPKNVSLT
KTISHTENLKTRKKGLKPGRKKKIHAVPCSPSSTAHINLSNLSNSNPVIFKDGIGIPGTT
AAVISTVCVYVNKHGNSGPHLDKKKVQLLPDHFGPGPVNVVLRQAVQACVDCAHQVKMVF
GFLKSGHHGGETITASFDGEKHATNLPSVNSASFVLRFLEKLCHSLQCDNLFSSQPFSPY
MGTAHSPTDYDRNKPAKEEISENRGTKRYSQDSPPYAAPLSPKLPRTEVHASEAEILPSE
ENGMPKEHRFSEQSMDSSLNSGNPVSPAYRNPTNCRTSTSTTYYRNSLQSVTTTSNSVPM
LHKLSLNPAGNNYYEGNRRRMQRRIEAASSTTGPDLNVLKREPSRGSNKDPSNWSIDEVM
RFVKEADPQALAPHAELFRRHEIDGKALLLLRSDMIMRYMGLKLGPALKLCYHIERLKQG
D
Download sequence
Identical sequences G3W9D2
ENSSHAP00000012037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]