SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3W9E1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3W9E1
Domain Number 1 Region: 143-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000167
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 2 Region: 62-182,277-283
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000133
Family Growth factor receptor domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3W9E1
Sequence length 293
Comment (tr|G3W9E1|G3W9E1_SARHA) EGF like domain multiple 8 {ECO:0000313|Ensembl:ENSSHAP00000012046} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=EGFL8 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
SGVRVLLCCLLVGFSVLLFFGGQRANGDLPYSKGVCSRQTLVIPLRYNESYSQPIYKPYL
TLCAGQRICSTYRTTYRVAWREVQRDVQQFHAICCQGWKKKHPGALTCEEAICPKPCQNG
GICIQPDQCECTPGWGGKHCHMDVDECSTGIILCSHSCSNTLGSFTCSCPKGLVLGTNGR
TCEEVPSEPLPSPSILSLTVREAKKEKHSLRLKVGELRGRLEVLEQWAGQVSAWVRAVLP
VSPEAIRPEQVAELWGRGDRIDSLSDQVLLLEEKLGACSCEDNSLGPGLNHGR
Download sequence
Identical sequences G3W9E1
ENSSHAP00000012046 ENSSHAP00000012046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]