SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WAJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WAJ9
Domain Number 1 Region: 80-158
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000029
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WAJ9
Sequence length 160
Comment (tr|G3WAJ9|G3WAJ9_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000012454} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MQSSTNSDTSAEKRNSSNQSTGAVQMRIKNANSHHDRLSQSKSMILTDIGKVTEPISRHR
RNHSQHLLKDVITPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRKIEFYKES
KQQALSNLKTGNKPECLDLCGAQIEWTKEKSSRKNVFQKT
Download sequence
Identical sequences G3WAJ9
ENSSHAP00000012454 ENSSHAP00000012454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]