SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WAK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WAK3
Domain Number 1 Region: 75-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000007
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 2 Region: 33-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WAK3
Sequence length 352
Comment (tr|G3WAK3|G3WAK3_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000012458} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MFVLEGKKKLVLSPQKKCCKGYKFILGQCIPEDYDVCSEAPCEQQCTDNFGRVLCTCYPG
YRYDRERHRNKVKPYCLDIDECATSNETLCSQICINSLGSYRCECREGYILEEDGRTCTK
GDKDFGNDRGHDEKVQNALKAETCCATCKEFHQMKQMVLQLKQKIALLPNNAADLGKHVT
VDKLLASNTYLPGPPGQPGGQGPPGSPGPKGSPGFPGVPGPPGQPGPRGSMGPIGPSPDL
SHIKQGRRGPVGPPGAPGRDGSKGERGAPGPKGSPGPPGSFDFLLLMMADIRNDIAELQE
KVFGHRTHSSAEEFPLPQEFSNYPDVLDFGSGEDYPKRTETRDSRIDKDLYP
Download sequence
Identical sequences G3WAK3
ENSSHAP00000012458 ENSSHAP00000012458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]