SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WBD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WBD0
Domain Number 1 Region: 158-266
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-20
Family Voltage-gated potassium channels 0.0041
Further Details:      
 
Domain Number 2 Region: 57-114
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000103
Family Voltage-gated potassium channels 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WBD0
Sequence length 375
Comment (tr|G3WBD0|G3WBD0_SARHA) Potassium two pore domain channel subfamily K member 12 {ECO:0000313|Ensembl:ENSSHAP00000012735} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=KCNK12 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
TVFSALESPSEAAARERWGATLRNFSAAHDVGEDELLAFLRDYEAALAAGIRADALRPRW
DFTGAFYFVGTVVSTIGFGMTTPSTVAGKAFLIAYGLFGCAGTILFFNLFLERIISLLAF
IMRACHERQLRRSGLLPPAFRRGSALSEADSLVGWKPSVYHVMLILGIFAILLSCCASAM
YTSVEGWDYVDSLYYCFVTFSTIGFGDLVSSQHEAYRHQGLYRLGNFLFILMGVCCIYSL
FNVISIIIKQVLNWMLKKLSCQCCGRCRRPSSRLGRRNAITPGSRLRHHLNALEADGHYD
SDAEGRRLSGEMISMRDLIASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGAL
GIMNNRRSGEKKARF
Download sequence
Identical sequences G3WBD0
ENSSHAP00000012735 ENSSHAP00000012735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]