SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WBD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WBD8
Domain Number 1 Region: 13-255
Classification Level Classification E-value
Superfamily SET domain 8.5e-65
Family Histone lysine methyltransferases 0.000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WBD8
Sequence length 299
Comment (tr|G3WBD8|G3WBD8_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000012743} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=LOC100918271 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MSEEQPGASLGGQRDVGRGLENLPVSSWPEGEEPEFQYTPEHVIGPGAEVDPTQITFPGC
TCLTTSCLPTICSCLLHGENYDNLCLRDIEGKMEFARPVFECNVMCQCSEQCKNRVVQRG
LQFNLQVFKTDKKGWGLRTLEFIPKGRFVCEYAGEILGSSEARRRIQQQTKHDSNYIIAI
REHICDGQIIETFVDPTNIGNIGRFLNHSCEPNLLMIPVRVDSMVPRLALFAAKDILPKE
ELSYDYSGRFRNFTKNDRNQEIPDKDKMGKPCYCATKSCAAFLPYDSSLYSPLEKQTTN
Download sequence
Identical sequences G3WBD8
ENSSHAP00000012743 ENSSHAP00000012743 XP_003762434.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]