SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WBN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WBN5
Domain Number 1 Region: 11-77
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 3.88e-16
Family Ovomucoid domain III-like 0.0053
Further Details:      
 
Domain Number 2 Region: 204-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000542
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 3 Region: 112-169
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000347
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WBN5
Sequence length 317
Comment (tr|G3WBN5|G3WBN5_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000012840} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
LNVRESDVRVCDESTCKYGGLCKEDGEGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRR
ASCKHQKEITVVSRGPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENV
GCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCVKQEQIDIRHLGHCTDTDDTSLLGK
KDDGLQYRPDVKDASDQREDIYIGNHIPCPENFNGYCIHGKCEFIYSTQKASCRCESGYT
GQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITSTNRKCPKNNRGRR
QKQNLGHFTSDTSSRMV
Download sequence
Identical sequences G3WBN5
ENSSHAP00000012840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]