SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WG24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WG24
Domain Number 1 Region: 74-203
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.02e-47
Family Regulator of G-protein signaling, RGS 0.0000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WG24
Sequence length 213
Comment (tr|G3WG24|G3WG24_SARHA) Regulator of G protein signaling 2 {ECO:0000313|Ensembl:ENSSHAP00000014379} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=RGS2 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MQSVMFLTFQPNCGSGSMEKTASGYPMGEEKREKMKRTIIKDWKTRLSYFLQNSSTPGKP
KVNKKGKQQAFIKPSPEEAQLWSETFDELLANKYGLAAFRAFLKSEFCEENIEFWLACED
FKKTKSPQKLTSKARKIYTDFIEKEAPKEINIDFQTKIMIAQNIEEATTGCFTTAQKRVY
SLMENNSYPRFLESEFYQDLCKNPQITRAPQAT
Download sequence
Identical sequences G3WG24
ENSSHAP00000014379 XP_003767581.1.9362 ENSSHAP00000014379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]