SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WG44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WG44
Domain Number 1 Region: 742-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000295
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 746-821,917-966
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000714
Family Growth factor receptor domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WG44
Sequence length 1138
Comment (tr|G3WG44|G3WG44_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000014399} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MEAGGRVIPSTETSTPSSLIHSSTSILETKTSNIFSQGRNHTKLPWPHFFRTSTYPSPSS
KSSSLEIRTEPKNSIAVNTLVSQTDRTNTFIQDVSETLQSTNRSWLANGTEDSTGSGMTS
SLGSTHASSSLGEARRKSTVTRDPNDAKFIKPSTDSTLGHSSSGTSALSVQNDSSTFEGA
HQLPFSDADVGNDNSKTQTEAGLSLETFTRDEKNTSHWSITNKSAFVDVNENSTVYPEIV
NPLVLTQLSKQWTGNHTGPDDTHLFEPSTESSSASSSEIFNSSYPRSEQSATGSNHGPMG
STLIGKRTPGYHTDSTYISSTFTKVKDRTLLSITNNSTSPDTIKTSTIYHRTSSSSALAQ
SPSTAVVTDRNNISSSEGQFVIPSTEPLVVSSSDLSTYTSTASVSPNTVLLQASESVSTG
DSSSSSSLPSFPSPSGSQLSQSSSSTPWPTLASSPLLFSMDESSKSISSSLSPLSTYGVE
STPSPTIFQQSLPHLSSTLVLPSGDPWARESSVTSIDTLKELFTTVVHSSPSVDQKNQSV
SYQEKTSTESKLQPPSLPPMEPKEVENNNSTAKAPLPPVPTESFREPTLLATSTNSALPS
SVMTTTSHATIPSSTISTDLPPPISVLTTVKATTKKTILPIGPRTTMSQRTTEGPVTSET
SRVETEATTKVIPTTGIVTPVQELTSTGRDQEEAIPTVHFPTESSLSPQITKASTSTPLT
LRPTTGVPLSSVRPLMTSPSTTVNRCATNPCLHDGKCIVDSTGHGYRCVCPSSWQGDDCN
IDVNECLSNPCPPLAVCNNTQGSFNCRCPIGHQLEKGVCNLVRTFVTETKLRKTFANATV
EKHSELRQVEDEIIKMLNMSLSTLPGYARSTVQAVRDSSTVVVSLQTTFSLASNVTVIDL
AERVQKYVSTCTAPVETCQFLKSLGGLFTIGSLCKKKSPECDKATSTCTDLEGIALCQCK
AGYFQFNKMDHSCRGARSGWRYKDRKNEQYSQKPRGPCSSPAYQLITVVIAAAGGGLLLI
LGIALIVTCCRKNKNDISKLIFKSGDFQMSPYAEYPKNPRSQEWGREAIEMHENGSTKNL
LQMTDVYYSPTNIRNPELERNGLYPTYTGLPGSRHSCIFPGQYNPSFISDESRRRDYF
Download sequence
Identical sequences G3WG44
ENSSHAP00000014399 ENSSHAP00000014399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]