SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WGA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WGA1
Domain Number 1 Region: 129-399
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-94
Family Protein kinases, catalytic subunit 0.000000000403
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-16
Family Pleckstrin-homology domain (PH domain) 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WGA1
Sequence length 402
Comment (tr|G3WGA1|G3WGA1_SARHA) AKT serine/threonine kinase 3 {ECO:0000313|Ensembl:ENSSHAP00000014456} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=AKT3 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
GEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPNTFIIR
CLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDA
STTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLT
ESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEI
VSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAP
EVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKS
LLSGLLIKDPNKRLGGGPDDAKEIMRHSFFVGVNWQDVYDKK
Download sequence
Identical sequences G3WGA1
ENSSHAP00000014456 ENSSHAP00000014456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]