SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WHW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WHW2
Domain Number 1 Region: 677-866
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.19e-36
Family APC10-like 0.0038
Further Details:      
 
Domain Number 2 Region: 862-954,1182-1260
Classification Level Classification E-value
Superfamily Cullin homology domain 1.31e-19
Family Cullin homology domain 0.0032
Further Details:      
 
Domain Number 3 Region: 1662-1716
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000118
Family RING finger domain, C3HC4 0.0035
Further Details:      
 
Domain Number 4 Region: 1504-1589
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000424
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 5 Region: 244-369,402-491,550-661
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000012
Family PBS lyase HEAT-like repeat 0.072
Further Details:      
 
Domain Number 6 Region: 2-24
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000872
Family CPH domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WHW2
Sequence length 1953
Comment (tr|G3WHW2|G3WHW2_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000015017} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
LQVLWQSTGRTYWVHWHMVEILGPVTEDKVTTEPEKGTGISSCLIPTVPPSLDWKPLGGL
YALPYLKPEAQTNTESGCLSQAEWWELLFFIKKLDGPEQQEFLQLLQENPDGETLEEEAL
GELSVPMELAQKLVLALSGQCQGSTHSDLLSSHVYSKYGPQPNTGHSVSPAPIVPQDTCT
PKASLPEKIKVEAEPPKAQNDSQLFNQLLVAEGLVLPPELKESAGELCSVLRGPGRRSSL
EQHVTEAIAMVQRSNSETNLQLSGLYALSKAVEEATGRDHPLLRPDKALREKLVKTLIEL
LTNQVGEKLLVVLALRLLYLLMAKHEWRPLFATEGGVYAVLVCMQEYKTSVLVQQAGLAA
LKVLASAGPCELPSGGSGRASPLAASEAQMIREIFASIGSAARPGTDNLLGAIPAAVILM
LQTEGCSSAVGNGLLLLNMLMCNHQALGEQLATQELQEALHSHCGGGPEPVPPTRTLILT
LLSRLSEHGPPGSPEHAAIVAEPPCPEPQAGTDEPLLRNLVGSAGPSGELLLELERSICP
EGSREGDVNQVLKRLQHQPQPFLLLLQSLETPGPNKSLHMTVLRILIRLLDFPEAILLPW
HEAMEPCLACMNAPSNDREVVQELIRFLHRLATLHKDCAVVLCRLGAREALTKALDKHTA
QLLLGPELRDLVSECEKHARLYSNLTTSILAGCIQMVLGQIEEHRRTHRPINIPFFDVFL
RHLCQGSSVEVKEDKCWEKVEVSSNPHGASKLTDRNPKTYWESNGSTGSHYITLHMHRGV
LVRQLTLLVASEDSSYMPARVVVLGGDNASSVSTELNTINVMPSASRVLLLENLTRFWPI
LQIRIKRCQQGGIDTRVRGVEVLGPKPTFWPLFREQLCRRTHLFYTVRAQAWSQDIAQDR
KRLLQLFPEVSVLVLSPRCWPVSPLCYLHEPTKYFPPALSTSLTRFSNFYSQSKRMGAQL
GHGAKKEILASGCMEMRQHSKLGAALPLESLILSILLFIEFKSSMEVRENRMDSDGHQGA
QMLLENNGMWLPLVPRVLSLFHQRLNPVLSFGKEKNKRWIIVFLGVKWQLSRAKYTTRVR
IKVIFNAKKKEKRKKKIFPYGFTTSGKAQTVQRTIIYEQCNLKILPEIPNILTLLLSIDC
KLSELYFISYETDTYKTERQTSVDSSFSTFSGQNRPVLELGPRRRLQWSWLGRAELLFGT
QTLHVSTLQMWLLLHFNKMKEVLLDTLLQSSDLSSELLHQALQPLTSALGPLSLHEGQDF
PPGGVLRLREVEKEPGGEALWLLPPQTYLSVEEDECRTLERKRNLLSCLLVRILKAHGEK
GLHIDQLVCLVLEAWQKGPSSPKGLGSNMGGEAGCSSADVLSCILHLLGQGYVRRQEDRP
QVLAYAAPEPADPQRGQANVPFCGTRSAVTSQLRPKEVAALASLQLPAGRTMSPHEVEGL
MEQTVNQVQETLSLEPDVALHLLAHTRWGADQLLQSYSEDPEPLLLASGLRVPLAQMPPP
LPTQCPVCVSPLSPEDQPPALCCMHYCCKSCWNEYLTTRIEQNLVLNCTCPIADCPAQPT
SAFIRAIVSSPEVIAKYEKALLRGYVESCSNMTWCTNPQGCDRILCRQGLGCGAACSKCG
WASCFNCNFPEAHYPASCSHMSQWVDDGGYYEGMSVEAQSKHLAKLISKRCPSCQAPIEK
NEGCLHMTCAKCNHGFCWRCLKPWKPTHKDYYNCSAMVSKAARQEKRFQDYNERCTFHHQ
AQEFTLNLRSCVSAISEMPPPQPLTFLIDACRGLEQARKVLAYACVYSYYNQDTERMDVV
EQQTENLELHTNALQILLEETLLQCQDLAASLKLFKAEHLSTGLELLRRIQERLLAILQH
STQDFRIGLQTPPSSEPQEVKVSNVPSNQPQGSSELGQEEEDEEDEDEVPGWQQDEYDDE
ELDDDNFSYDDESENLDRDTFFFDDEDEDEGYD
Download sequence
Identical sequences G3WHW2
ENSSHAP00000015017 ENSSHAP00000015017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]