SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WJ38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WJ38
Domain Number 1 Region: 16-210
Classification Level Classification E-value
Superfamily vWA-like 1.07e-53
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 443-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 531-607
Classification Level Classification E-value
Superfamily vWA-like 0.0000000014
Family Integrin A (or I) domain 0.01
Further Details:      
 
Domain Number 4 Region: 490-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000288
Family EGF-type module 0.036
Further Details:      
 
Domain Number 5 Region: 251-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000297
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WJ38
Sequence length 607
Comment (tr|G3WJ38|G3WJ38_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000015443} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
CSQLLILFLVSVNAESQVTPGSKCRTGPLDLIFLIDSSRSVRPFEFETMRRFLVNIIRGL
DIGPNATHVGVIQYSSQVQSVFPLGAFFRREDMERAIQAIVPLAQGTMTGLAIQYTMNVA
FSVAEGARPPQARVPRVVVIVTDGRPQDRVAEVAAQARNRGIEIYAVGVQRADVGSLRAM
ASSPLDEHVFLVESFDLIQQFGFHFQGRLCVFFLTLSSSPSVKNDVGWDGSESFEKSQLI
PLFPHGSVSPGADPCIDGTHGCQHLCVSTPESFRCDCNPGYRLAPNNKSCSGMLLEQNTC
ETRGKDCFVEQHPPFWSDQTSSTQKQLWALGFSRAKYCKKIKVQRREVFQFAVLTTLAST
CFTSLNLVSYNFKCLHTYVDMYICMYVVSHSFHTLRPTLWKVPVVESFWLKPGHMECNPI
NNGDQCPAKDEEGFRYYRRVEMYTTIDHCAEGTHGCEHLCIKSNGSYTCGCRKGYTLHRD
QRHCTLIDHCSFGNHSCQHECVNFPEGPRCRCRQGFELQSDGRHCKARDYCNGVDHGCEY
QCVSSGSSYSCICPEGRQLQADGKSCDRCRAGHVDLVLVIYGSKSVWPQNFELVKRFVNQ
IVDFLDV
Download sequence
Identical sequences G3WJ38
ENSSHAP00000015443 ENSSHAP00000015443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]