SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WK26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WK26
Domain Number 1 Region: 78-432
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.06e-83
Family Protein kinases, catalytic subunit 0.000000366
Further Details:      
 
Domain Number 2 Region: 2-75
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.79e-17
Family Regulator of G-protein signaling, RGS 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WK26
Sequence length 484
Comment (tr|G3WK26|G3WK26_SARHA) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=GRK5 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MKYLTPESPEYVTEVNQDLIHQTKEKLELRPCKELFSHCAKSVLDYLSGEPFQEYLESMY
FDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRK
GESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEE
RALFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIQGRV
GTVGYMAPEVLNNQRYGLSPDYWGLGCLIFEMIAGQSPFRGRKEKVKREEVDRRVLETEE
VYSHKFSEEAKSICKMLLAKDAKQRLGCREEGAMEVKGHPFFRNMNFKRLEAGMLDPPFV
PDPRAVYCKDVLDIEQFSTVKGVNLDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNV
FGPNGTLSPDLNRSYPPEPPKKGLLHRIFKRQHQNNSKSTTNSKANFNHHINSNHVRSNS
TGSS
Download sequence
Identical sequences G3WK26
ENSSHAP00000015781 ENSSHAP00000015781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]