SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WM53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WM53
Domain Number 1 Region: 370-551
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.81e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 245-337
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000288
Family WWE domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3WM53
Sequence length 551
Comment (tr|G3WM53|G3WM53_SARHA) Poly [ADP-ribose] polymerase {ECO:0000256|RuleBase:RU362114} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
SCLYRKQCKYNHSTDSLHNMTILKSHGIDNLNLNELCQLLLQNDSTLLPELCFLFWEGND
LSFFNCLYHSDSANFQMMISNPLKLDYNFSLVCEPSHSFQASPTTSLGVMGPVLDSLEAV
IALVLHLLILFLQAFINIQRVALLHIKTKVLHKPGYNYIMFFIVSLGYTIFLDKCFNVHF
HLPYRWQFFDGNTWKDLEEMENIEKEYCNPKSWQYFAKKPTSFLINFDNMSGGCYKVRRL
STASSVVKPPHFVFTTQWLWYWKSDGGLWQIYGLKGTERHVAAVNSTDIEKAYMSQESPI
LQFSIGKHNYELNFKAMTQKSLHFGTVRVVCRRPKYVSPEDLKMKQTWGDKLAAPKNVPS
HWDMSALPELGFKLIALSPSTGEYLKVQEQFCRTMPKYTIHKIERIQNPALWEVYQWQKA
QMKKSNGGQEVDERFLFHGTGPKYIEAICHQNFDWRICGLHGTSYGKGSYFARDAAYSHH
YCKSSVKPQPMFLARVLVGEFTRGSSSYLRPPAKEGQSNTFYNSCVNSLSDPSIFVIFEK
HQIYPEYLIWY
Download sequence
Identical sequences G3WM53
ENSSHAP00000016508 ENSSHAP00000016508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]