SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WMT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WMT5
Domain Number 1 Region: 463-561
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.9e-39
Family MBT repeat 0.0000882
Further Details:      
 
Domain Number 2 Region: 383-503
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.17e-33
Family MBT repeat 0.001
Further Details:      
 
Domain Number 3 Region: 164-270
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.76e-28
Family MBT repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 254-352
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.46e-24
Family MBT repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3WMT5
Sequence length 628
Comment (tr|G3WMT5|G3WMT5_SARHA) Mbt domain containing 1 {ECO:0000313|Ensembl:ENSSHAP00000016740} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=MBTD1 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MFDGYDSCSEDTSSSSSSDESEEEVAPLPSSLPIIKNNGQVYTYPDGKSGMATCEMCGMV
GVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLQKQPLVAKLAAYA
QYQATLQSQAKTKSAVSLEGFSWGNYINSNSFIAAPVTCFKHAPMGTCWGDISENVRVEV
PNTDCSLPTKVFWIAGIVKLAGYNALLRYEGFESDSSLDFWCNICGSDIHPVGWCAASGK
PLVPPRTIQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPSMRVEVVDKTHLC
RTRVAIVESVIGGRLRLVYEESEDKSDDFWCHMYSPLIHHIGWSRSIGHRFKRSDITKKQ
DGHFDTPPHLFAKVKEVDQSGEWYKEGMKLEAIDPLNLSAICVATIRKVLADGFLMIGID
GSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPV
KLFNKDVPNHGFRVGMKLEAVDLMEPRLVCVATVTRIIHRLLRIHFDGWEEEYDQWVDCE
SPDLYPVGWCQLTGYQLQPPAPQTSRESQSGSSKQKKKAKSQQYKGHKKMTPLQLKEELL
DGEEYSFLQGASDQESNGSASYYIKQEP
Download sequence
Identical sequences G3WMT5
ENSSHAP00000016740 ENSSHAP00000016740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]