SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3WMU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WMU3
Domain Number 1 Region: 3-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-73
Family Calponin-homology domain, CH-domain 0.00000452
Further Details:      
 
Domain Number 2 Region: 1486-1693
Classification Level Classification E-value
Superfamily Plakin repeat 7.19e-45
Family Plakin repeat 0.00022
Further Details:      
 
Domain Number 3 Region: 1698-1879
Classification Level Classification E-value
Superfamily Plakin repeat 3.4e-36
Family Plakin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 216-332
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 6473-6632
Classification Level Classification E-value
Superfamily Spectrin repeat 4.18e-27
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 6 Region: 6299-6416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 6714-6850
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-26
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 4501-4662
Classification Level Classification E-value
Superfamily Spectrin repeat 1.29e-25
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 9 Region: 5813-5972
Classification Level Classification E-value
Superfamily Spectrin repeat 2.37e-25
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 10 Region: 5271-5427
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-25
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 11 Region: 6145-6295
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-23
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 12 Region: 4832-4988
Classification Level Classification E-value
Superfamily Spectrin repeat 5.65e-22
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 13 Region: 6844-6960
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-21
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 14 Region: 6629-6744
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-20
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 15 Region: 7207-7286
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.54e-20
Family GAS2 domain 0.00059
Further Details:      
 
Domain Number 16 Region: 6910-7041,7071-7098
Classification Level Classification E-value
Superfamily Spectrin repeat 7.47e-19
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 17 Region: 4064-4194
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-17
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 18 Region: 5422-5538
Classification Level Classification E-value
Superfamily Spectrin repeat 4.17e-16
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 19 Region: 7118-7198
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000171
Family Polcalcin 0.044
Further Details:      
 
Domain Number 20 Region: 650-752
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000187
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 21 Region: 4723-4844
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000864
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 22 Region: 5488-5646
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000123
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 23 Region: 5716-5829
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000853
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 24 Region: 5046-5207
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000747
Family Spectrin repeat 0.023
Further Details:      
 
Domain Number 25 Region: 1205-1318,1345-1373
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000152
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 26 Region: 4252-4372
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000199
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 27 Region: 3797-3919
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000932
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 28 Region: 3941-4060
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000119
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 29 Region: 5977-6094
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000158
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 30 Region: 4411-4518
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000248
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 31 Region: 557-649
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000275
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 32 Region: 725-832,953-971
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000018
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WMU3
Sequence length 7503
Comment (tr|G3WMU3|G3WMU3_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000016748} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
VRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKKRQVKLV
NIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQTTEGYAGI
RCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPE
DVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGISANDVEVKWIEYQNMVNYLIQWIRHHV
TIMSDRTFPNNPVELKALYNQYLQFKETEIPPKEIEKSKIKRLYKLLEIWIEFGRIKLLQ
GYHPNDIEKEWGKLIIAMLEREKTLRPEVERLEVLQQIASRVQRDSIVCEDKLILARKAL
QADSKRLESGLQFQNEAEIAGYILESENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRD
EIMALRSECSSVYSKGRSLTTEQTKLMISGITQSLNSGFAQTLNPCLNSGLTQSLTPSLT
PSSMTSGLSSGLTSRLTPSVTPSYTPGFPSGLIPNFGSGVDTNSLQTLKLMQIRKPLLKS
SLLDQNLTEEEINVKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEF
ESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQEQHLDTLHNFVSRATSE
LIWLNEKEEEEVAYDWSERNSNISRKKEYHSELMRELDQKEEVIKSVQEIAEQLLLENHP
ARLTIEAYRAAMQTQWSWILQLCHCVEQHIKENSTYFEFFNDAKEATDYLKNLKDAIQRK
YSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIASLMGRAKTIIQLKPRNPDNPLKTSIP
IKAICDYRQIEITIYKDDECVLASNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAIDT
ANRIEQQFQNVLALWHESHINMKSVVSWHYLVNEIDTLRASNVASIKTMLPGEHQQVLSN
LESRFEDFLEDSQESQIFSGSDITQLEKEVNVCKQYYQELLKSAERATEEQEESVYNLYI
SEVRNIRLRLENCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELDRLKDDLATITDK
CEEFFSQAAASPSTPTLRSELNIIIQNMNQVYSMSSIYIDKLKTVNLVLKNTQGAEALVK
LYETKLCEEEAVTADKNNIENLMSTLKQWRSEVDEKREVFHALEDELQKAKAISDQMFIT
YKERDLDFDWHKEKADQLAERWQNVHTQIENRQLRLRDLEAIGKSLKYYRDTYHPLDDWI
QHVEDTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQNKMDECQKYSEQYATAVKDYE
LQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLK
RLEEEEKSLEEEKKEHVEKAKELQKWVSNISKTLKEGEKAGKSSFSKQQISSEEIAMRKE
QLSETLQTIQLFLAKHGDKLTDEERNEMEKQVKSLQEGYNLFSDSLKQLQESNILRDEKV
EEKLDKVIAGTIDQTTGEVFSVFHSILKGLIDYETGIRLLEMQLIFSGLISPELKKCFDL
QEAKNHGLIDGQILFQLEELGRAKEIISSSSSTTIPVLDAFDKGMISESVAIRILEIQLS
TGFLIIPSTGEYLTLQKAFQRNLISSALFSKLLENQNLCKDLIDPNTSEKVSLVDMVQRS
ILHENTGMRLLPIKPREGGKITLKCGRKISILRAAHEGLIDRETMFRLIGAQLLSGGLID
SDSGQRMTIEEAVQEGAIDLGTANCILTHQVQTGGIISSNPPKRLTVDEAVQCNLISASS
ALLILEAQRGFVGLIWPHSGEIFPASSLHQKLITNELAYKILNGRQKIAAIYIPETSQVI
GLDAAAQVGVIDHNTASILKNIILPDKMPDAGDLNTSAGRWLSSCEFQPSTIFHEYTQPE
VISGGGECMEPQTLEQSENLFLSYLMINSYMDANTGERLLLYDGDLDEAISTLLENDNTA
FGAMSAKKELIGTNLRKFGDVLFNKKDECSLSSFDGTCFKDPENAIDLQTKESAVSEEFN
EKEDHFINNKCDQLECLPQIMLARDLADVHIVNDRVDLMRLGKMNSAMLSGDYENVFKSC
KDGNQVVISANVDKCTYSENIQNDFPSDANKNFIGVSSRKLCVQNKTENQDNRIEDFNIS
ENSSEIDLFHSDRMGVHLGSSNNMFTPDSCFQKSLISLPFSDQAISLDPEIAKRFQGRLL
DSKDISINSPRRSSESKSLNVDFNAPQLQCQRDSFDSSDYSGNQTENDKRQVVISHPESK
INQDDSKLEEYSVNSVLSNNTENTDTSDICGFQQLEETNGVEDSQDSQLEDNESDTESDD
DSYSTPLLEDDDHDSLLLEDDDYDCLEPEDFDMLQHEADGILHRGCVCADISMGNISHIV
TQGERSDLINVQKEEQSPQEFFKVSKENELHSDERLNIDSVDIEVTNDRLLDTISEEEST
SNFEDDVPGTITSKNTERKNFHVSLEAGETEYLIGRREQEFGQEVGFDVDQNVQCMKNED
SYRNGKYLPTVNNQIECDRKSMLDMFTFQGKDGNFKDIQVSGTSHEKKEDSEEIVGINMT
KIKSTKETQKFLNLETFQDVNVLQPESTSGNNLVNKGVTLPECMSEIVNQIRESQLNITE
RNPEEFAEEKLTLHSFTHVKESEKRVATDSVLCNNNINPISQIDTRDSGNTETKISQPGL
DSLFAGKDRNHTESLICTIENTCSDADIIEKSSQVSHPKMMTDSIDQDHQRKETNGQVEK
KYDEHKILIKEDIPIPHEIKLFDRSVGDYDKDLNHFPRESNCPFPKITSSEEYSQTEKVK
EASTDLAKESKDLQVLIVKNPVHLENLGEIFDISASKMVSEIDIKSGRSSTKETEGLSDK
FLSESEEEVDLFSYLKKCAKHITVKSSAKLNSDGHIPILTSDLLTDKQLQSGIDGTREKK
EDVCINETALNLNTKQPDLGKESVITQTTSEEETFTLSDLPLKTLDYVNKNADMQTDLET
SLCKKEINNKTIDISGIEISSLEVNKKEATGQQPLKEWTLSPESHATETQTPELSYLIVD
NLKDILKRRLKEGCIFFGEEGEFSSYSERKVLMQNLLKMVSLTQLVKKSSNKFSDSKTSD
YSTVSQMTDPLEVKPEIHDNSSPLWPTNLGPELLLDILKQSQGGQKISGAFEMKGISLNE
NDSERNDIASKVLPLQLENIFHILLADEHSPKLELVADLNRNLPTSFQTEGERIYGPDES
PEIKKSECSFNSENTRETDRIASTSVESMGHSIGFQSEQSLGTLHNISPNHLEHPLDSKE
EASGNSLFPKFPSVLQLCLQHTEKMHGYLTMLQDMKLPLDNQQSLDNNLETLKNQLQQLE
SFELGLAPFSALVKKDMKLAEEFLNSHTSNIHKEQLEDLIISHKKLQKELLSLYDLSSKR
TKQIRLAIDSEMSKLTASHEEFLHKLQKFSDWITERRKTVNDLAADTGDGKNVKETLELL
KTILKELGHSKIQLETTAFDVQFFISEYAQDLSPNQSKQLLRLLNTTQKCFHDVQESITA
QMEILETHLHIEQDRNDQKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAIVIGDSKD
ELKLYQTKQENKELQKEMQKSAQALTEKVNNTEKFLMENGEKLSQEDKALIEQKLREAKM
KCEQLNQKAEQSKKELDKAVTTAIKQETEKVAAVAQLEESKNKIEDLLDWLSNVDKEGER
AGKKSHQEIEQNGTHFQEGDLNSMIGEEDEVNGNVMEMDVDGQVRTTEKNLNQQYQKVKA
QHEKIVAQHQAVIIATQSAKALLEKQGHYLSSEEKEKLERNLKELKTQYETALAESEKKV
KLTNSLQEELEKFDTDYSEFDSWLQQSEQELENLEAGADDFSGIITKLKRQKSFSEDVIS
HKGDLRYITISGHRVLEAAKSCSKRDGGKGDKDNFDTSATYKEVQGKLDLASERFKSLYA
KCNVLGNNLKDLVDKYQHYEDASSGLLSGLQSCETAANKHLLEPIATDPKNLQRQLEETK
VLQGQVSSHQVAVEKLKKTAEVLLDTRGALLPDKNDIQKTLVSDDIVGRYDNLSKSINER
NEKLQITLTRSLSVQDGLDEMLDWMGSVENSLKEQGQVPLNSAAIQDIISKNMMLEQDIA
GRQSSIKAMNEKVKKFMDTTDPSTASSLQAKMKDLSVRFSEASKKHKEKLDNLEKLKTKV
ESFEKLSEKLQSFFETKTQALVEMDGPGKDVTELSQYIEESNNEVLECKKDFETLQNLLK
ELSTHGFPGDKALLLEKTNTLSKKFKELEDSIKEKKEAISSCQEQTETFQLLVKHIKTWM
EETTEKIPIIQPSMGIDDLKKSLEETKKLQGEWSSKAPEIQKVNNKGTSLCNLISAMTSP
TKAIAVIKSGGTVLNGEGTTSDTKEFLANKELTSVKKKMAEINNSYENLGVTLKDKIFEL
DAKLTILQKAQEESSSMLQWLEKMDKKATVWDTTPTDSESVKTQVEQNKTIETELKQNMN
KVQELKDKLTDLMEQNPYSPEAPKWKQMLSEIDSKWKQLNQLTADRQQKLEESSNNLTQF
QTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQKQQVQILLKEFDTRKPQYEQLTTTGQ
SILSKPGEHHPLHGTVKEQLTVVSQKWDSLTGQLSDRCDRIDQGIVKSTQYQSLLRNLSD
KLSDLDNKLSNSLAVSTHPDAMEQQLETAQKMKQEVEQEMKNIKMAQTLCEELSALVGEE
YLKAELSRQLEGILKVFKNIEQKSGNHVQQLQSAYASSHQFQQMSKDFQAWLGKKKEEQN
QFYPVSAKLDVLQELIKEQKEFKKAVIDHYDSYEKIIAEGENLLLKTQETEKADLQLQLN
TIKINWDGLIKQMTERQEKLNDCLEKALKYREHVDNLRPWLDKCQNNLMEIEVCPDPEET
EKLIAKVKTLQKEMDQRFGMVELLNNATNSLLSASETDKEVVTEENKTLIQKVDMVTEQL
HSKKHSLENMAQQLREFQENIREAHRQLRCVKEQLEVHNSLGPQACSNKHLTVMQAQQKS
LQSLKPQIELAKRFAQELVLEASDSKGTSDLLLEAESLEHEHSEVSQQVEEKCSFLETKL
QGIGHFQNTIREMFSQFAEFDDELDSMASVGRDRDTLQRQKSDIKNFLKKLEDLITDNEN
ANKTCKMMLTTEEPSPDLVGSKRDLEALSKQCNKLLDRAKAREEEVEGTIFRLEEFYSKL
EKMYNLLQKAEEHEESQGTVGMETETINQQLNVFKAFQKEEIEPLQVKQQEVNWLGQGLI
QSAAKSTSTENLEHDLEDVNARWKTLNKKVAERAAQLQEALLHCGRFQDALESLLSWLVD
TEDLVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKPTIEGIKTEGQKIAATAEPADKVK
ILKQLSLLDTRWDTLLNKAETRNRQLEGISVVAQQFHETLEPLTEWLTTTEKKLTNWEPI
GTQASKLEEQIAQHKALEDDIINHNKTLHQALSIGQSLKILSSREDKDMLQEKLDFFQVW
YIEIQGKSHIKSELLQQAFSNAQIFGEDEVELITWLNEVHDKLSKLSIQDYNIHGLSKQQ
SELLALQEDILLRKQNVDQALQNGLELLKQATGDEVLIIQDKLEGIKARYKDITKLSSDV
SKTLEQALKLSGKLQSTHEELCSWLDKVELELLSYETQDVKGEELSQAQERQKELKKEAK
SYKELVDALNEVSSALLELVPWRAREGLDKMVTEDNERYRLVTDTLAQKVEEIDAAILRS
QQFDQAADAELSWIAETEKKLRSLGDIRLEQDQTSAQLQVQKAFTMDILRHKDIIDELVK
SGDKIMSSCSEEEKKSMKKKLHNVLKNYDDICQINSERYLQLEQAQSLVNQFWETYEELW
PWLTEIQRVISQLPAPALEYETLKQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPG
EGFLIQEKYMAADTLYSQIKEDVKKRAVALDEAISQSTQKFHDKIDQTLESLKRIVERLR
QPPSISAEVEKIKEQINENKNVSVDMEKLQPVYETLKQRGEDMIARSEGTDKDLSAKAVQ
DKLDQMILIWEEIHTLAEEREAKLLDVMELAEKFWCDHMSLVVTTKDTQDFIRELEGPGI
DPSVVKQQQEAAEVIKEEIDGLQEELDMVVNLGSELIAACGEPDKPIVNKSIDELNSAWD
SLNKAWKERVDRLDDAMQTAVQYQDGLQAIFDWVDIAGGKLASMSPIGTDLETVKQQIDE
LKQFKSEAYQQQIEMERLNHQADLLLKKVTEESDKHTVQDPLMELKLIWDSLDERIINRQ
HKLEGALLALGQFQHALDELMTWLTHTEDLLNEQKPVGGDPKAIEIELAKHHVLQNDVLA
HQSTVEAVKKAGSDLIESSAGEEASNLQTKLEVLNQRWQNVLEKTQQRKKQLDNALHQAQ
GFHGEVEDLHQWLTDTERHLLASKPIGGLPETAREQLDTHMELCAAFEVKEETYKCLMQK
GQQMLARCPESADTNIDQDINNLKEKWESIEAKLSERKARLEDALNLAMEFHNSLQDFIN
WLTQAEQTLNLASRPSLILDTILFQIDEHKVFANEVNSHRDQIIELDKNGTHLKYFSQKQ
DVVIIKNLLISVQSRWEKVVQRLVERGRALDEARKRAKQFHEAWSKLMEWLEESEKSLDS
ELEIANDPDKIKTQLTQHKEFQKALGAKHSVYDTTNRTGRSLKEKTSLTDDNLKLDDMLS
ELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDMDL
VMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCAL
SVSKQTRLEEALRQAEEFHSVVHVLLEWLAEAEQTLRFHGLLPDDEEALRNLIDQHKEFM
RKLEEKRAELNKATGMGEAVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASA
LAGLIAKQELLEALLAWLQWAETTLSEKDKEVLPQEIEEVKTLIAEHQSFMEEMTRKQPD
VDKVTKTYKRRAADPSPLQSHIPVLDKGRAGRKRSPTSSLYPSGSQTQIETKNPRVNLLV
SKWQQVWLLALERRRKLNDALDRLEELKEFANFDFDIWRKKYMRWMNHKKSRVMDFFRRI
DKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY
KPLTDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTV
MVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTTQPTIAKGRTNMELREKFI
LADGAAGQTAMAAFRPRGRRSRPSSRGASPNRSTSMSSPAGQVASPQAPVMSTPKGTPIQ
GSKLRLPGYLSGKGFQSGEDSGLITTAATRVRTQFADTKRTPSRPGSRAGSKACSRSSSR
RGSDASDFDISEIQSVCSDMETVPQTTRPTPRAGSRPSPAKPSRIPTPQRKSPASKLDKS
TKR
Download sequence
Identical sequences G3WMU3
ENSSHAP00000016748 ENSSHAP00000016748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]