SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WN19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WN19
Domain Number 1 Region: 746-838
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.49e-27
Family Tudor domain 0.0012
Further Details:      
 
Domain Number 2 Region: 523-617
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.07e-25
Family Tudor domain 0.002
Further Details:      
 
Domain Number 3 Region: 967-1061
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.77e-24
Family Tudor domain 0.002
Further Details:      
 
Domain Number 4 Region: 293-387
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.26e-20
Family Tudor domain 0.0013
Further Details:      
 
Domain Number 5 Region: 166-212
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000106
Family MYND zinc finger 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WN19
Sequence length 1184
Comment (tr|G3WN19|G3WN19_SARHA) Tudor domain containing 1 {ECO:0000313|Ensembl:ENSSHAP00000016824} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=TDRD1 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
CDFQLQFDKMSRNNSDISACKVTEQLNIERNEIKPPHEPLRSPRSYPNFKLKSPEHGSKT
VGIAKKNFLFCEQTKRYFASCENSSPPSNSNCINKEAVGSKIDKKTSTGNSVATLNIGNN
LPTKELNTKLSTHLSPAKPKMLQNLSENPLSLNYDSKLFNSLIPSPRSTTCHRCGLYGSL
RCSQCKQTYYCCVACQRRDWSAHSIVCKPIKQNFPKPDDTKLSCETKKMEVNKEDDYQLG
ITTEIIGSTKKIMFSDLQNLQLRKTMEIKGTVTEFKHPGEFYIQICSSEVLEYIRKLSTS
LKESYMNMMPQEEYIPIKGEICVAKYSVDQTWNRVIVQDVDVQQKKAQVLYIDYGNGEVI
PISRIQQLNKNIELFPPCAIKCFVANVIPAEGSWNNDCTNAIKPLLVEQYCSLKILDILQ
EEIISFAVDVLLPGSGKHLDHVLLEMGYGLRPKGQNSKMQSSDKSDFEDSGEKTSKDKTT
TECKSNLIPKVLSLNVGDEFCGVVAHIQTPEDFFCQQLQSGRQLAELQLSLSEYCNKMST
QSDFYPAIGDICCAQFSEDNQWYRASVLAYASEESALVGYVDYGNFEILKLNRLCPMAPR
LLELPMQAIKCILAGVKPSSGIWSPEAICLMKKLIRNKMITVKVVDKKENSSVVELIDKS
IKPSISVSKILIEAGFAVGEGKILTTDTSNELREINAPLTVEETVNTFEWTWVELAVNET
VNVMVCMLYNPGEFYCHILKEDALSGLNEVNRSLAEYCQQKMPNEFKPEIGEPCCAYFTG
DGNWYRALVKEILPNATVKVHFVDYGNIEEVTVDKLRKMSSKFLKLPFQGIRCWLVDIKP
RNKHWSKEATARFQMCVAGIKLKAKIVDLTDNGAGVELTDPSTAYPKIISDILIDEHLVL
KDEPPCKDTQNSKPVDLPFDPDVLQATSSDQWKTIEFPVDEIVPACILEIISPSLFYALP
IESRADQEKLNLMTVKLTDHCNSQKNRALFKPRIGDVCCARFTSDNYWYRAIILKVSESE
VKVLYADYGNIETLPFSRIQPITTIYLELPFQIIRCSFEGIMELEGGWSPLVLEQLKKLM
LNQNVMISVKGIIKNVHAVSVEKRSENGTINIADKLVMEGLAKHIATKNQSVLNKDKIQF
LIGQTNCCCTELRKQVEKHEQILLFLLNNPTNQDKFTEMKKLLK
Download sequence
Identical sequences G3WN19
ENSSHAP00000016824 ENSSHAP00000016824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]