SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WN40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WN40
Domain Number 1 Region: 629-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000571
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-40
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-36
Family Second domain of FERM 0.0000737
Further Details:      
 
Domain Number 4 Region: 29-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-22
Family First domain of FERM 0.0012
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 3.19e-20
Family PDZ domain 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WN40
Sequence length 922
Comment (tr|G3WN40|G3WN40_SARHA) Tyrosine-protein phosphatase non-receptor type {ECO:0000256|PIRNR:PIRNR000927} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=PTPN4 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MTARFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDIVFK
HLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNLRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPYNTAALLASFAIQSELGDYDHSENLPGYLSDYSFIPGQ
PQDFEKEIAKLHQQHLGLSPAEAEFNYLNTARTLELYGVELHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSLSDERLETQSLPSRSPPGTPNHRNSAFTQEGTRLRPSSVGHLV
DHIVHTSPSEVFVNQRSPSSTQANSIILESSPSQETSEDGQPPALPPKQSKKNSWNQIHF
SHSQQDLDNHINETFDVPASPEKSTPNGGIPQDNLVLIKMKPDEYGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDITEHTHDQVVMFIKASCERHSGELVLL
VRPNAVYDVVEEKFENEPDFQYIPEKSPLDGVHQNDNALRESMVQLAEGLDSGTILTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKDNDDYINANYINMEIPSSSII
NQYIACQGPLPNTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPELTESSLYGTFQ
VTCHSEEGNSAYVFRNMTLCNLEKNESRQLIQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPIIVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFIKPLKT
Download sequence
Identical sequences G3WN40
ENSSHAP00000016845 ENSSHAP00000016845 XP_003763841.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]