SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WN52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WN52
Domain Number 1 Region: 204-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 36-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000655
Family EGF-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WN52
Sequence length 712
Comment (tr|G3WN52|G3WN52_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000016857} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
VCATCHVHATCQQRDGKESCICNYGFVGNGITQCHDKDECQYGATVVCGNKTSCHNTLGG
FYCVCLEGYRATNNNKTFIPNDGTFCTDHVSSRCVCSSLCRCWEKCHEAHKFFYCQCSVR
NRPIWSWDHIYPTLINNCQTSCSSFSPPSPPPSPLDGRMTSRCSSQVSILCHKGYLSGRE
RYIDKASLLKTQERNSYHCQDAEIKCGSPPVIQHAILVGNYSSNLGSIVYYTCVDGFEST
GGNLTSLCTAEGIWKKNTLHCTEKKTSITNVFVFNDTCVKWRVSPGREDLKMAYLIHIQG
QQRDRTEFVHEDLLNFTTSSQEPEVCLHLDQGTNYTVTIRITFPRLSVPVTVRIQTADIS
LYYDDGSLNVSIFNETCLKWKRNPRDIAEKQIYQFQVLGQRQYQNNFYHETSFNFTTRER
FPEVCLDLYPRTYYTINITTMAFPKHSAHIIIATPRSVKQIISNISVLNETCLRWKRNMK
MDDSEEMYLFHIWGRRGYQKEFDQEVSFNLTTGSWAPEVCLELYPGTNYTVNITAASSGL
PVVVSLMTQITEPPIPNIEFIAVQGDPLPALSLRKAEDRNGPISSYQVLVLPLALQSKFL
CDSIQNTTFFTNDSSTKGYVAAEFLAKDITDVQEISLGDRLYYGKFYNAPLKPRSDYCII
LRITSEWNQVHSESLKNKNAIQNISIHFLFMGPGFNIEIVLVIMTLWSASLL
Download sequence
Identical sequences G3WN52
ENSSHAP00000016857 ENSSHAP00000016857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]