SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WQ06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WQ06
Domain Number 1 Region: 58-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family EGF-type module 0.024
Further Details:      
 
Domain Number 2 Region: 101-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WQ06
Sequence length 742
Comment (tr|G3WQ06|G3WQ06_SARHA) Adhesion G protein-coupled receptor L4 {ECO:0000313|Ensembl:ENSSHAP00000017511} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=ADGRL4 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MKLIPLLVCLSTLLDGAFAQNCARTHCNPKAKCEIQNGVEGCYCFPGFTGNGITICEDDN
ECENSTQPCGENANCTNTEGSYFCMCAPGFTSSSSQIKFVTNDGTTCIDIDECREATPGV
CGDHAKCENVYGGYHCVCKEGYQPSTGKFQFKPNDGTYCQENMKANCHLDDVCIAANINK
TLIEIKHTKEPLNLLQEIYQNSEQALFPIDILTNVEALSTFSPSLCFMSSNVSEKEAFTN
TTINVFVNTVNNLVQKDKITIWDKLSADNRRTSLTKLMHTAEQTMLNMSQNFKKTTQLEI
NSSDMGLKLLAFDSHHMKHIHPHVNMEGNYIKIYPKKKDENYSNGTVVVVFLHYKSIGAM
LSSSLSASQETESNNNPEQEEIVISSIVSVSVSAKPSAFYQLEKIMFTLSHVKPREKDSS
ECAFWNYSSNTMNGSWSTEGCELMHSNSTHTSCKCNHLTHFAILMSSGASIGIKDYNILT
RITQLGIIISLVCLAMCIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVGINTNSNKL
FCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLSPAVVVGFS
AALGYRYYGTTKVCWLSTENNFIWSFIGPACLIILPNILTFFPLFYLVFLHFRTVNPGAS
CIVLIMSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTICNAFQGMFIFIFLCVLS
RKIQEEYYRLFKNVPCCSGCLR
Download sequence
Identical sequences G3WQ06
ENSSHAP00000017511 ENSSHAP00000017511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]