SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WQD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WQD0
Domain Number 1 Region: 59-189
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.2e-37
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 362-463
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-31
Family Ras-binding domain, RBD 0.00017
Further Details:      
 
Domain Number 3 Region: 307-375
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-19
Family Ras-binding domain, RBD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3WQD0
Sequence length 580
Comment (tr|G3WQD0|G3WQD0_SARHA) Regulator of G protein signaling 14 {ECO:0000313|Ensembl:ENSSHAP00000017635} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=RGS14 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MPGKAKHLGVPNGRMVLAVSDGELSNVAGPEGAGEGRGSTLSVPSLPSGPTSPFTSEEQP
VASWALSFERLLQDPLGLAYFTEFLKKEFSAENLSFWKACEQFQQIPASDTQQLAQEARC
IYEEFLSSQALNPVNIDRQAWLGEEVLATPNPDMFRVQQLQIFNLMKFDSYARFVKSPMY
RECLLAEAEGRPLCEPGTSDPGSPNTTFRKKPKLKPGKSLPLGVEDLGQLPNTEAFGGRG
PRKSFRRELGTTNGNPALRRESQGSLNSSASLDLGFLAFVSSKSETQSHRKSLGGPEGEG
ESRVGRYCCVYLPDGTASLALVRPGLTIRSMLASICEKRGLSLPDIKVYLVGNEQKALVL
DQDCTVLADQEVKLENRISFELEIIPLGKVVRITSKSSKRLKEALFPILGKHGLSLQQIS
VYLSGEKRTLDLEKLVSSVSAQRLVLDTLPGVKITRTESTSPSQSQGGPLQTEGKTSQPS
SLLTNSLGQGPRSTGKRHTCDIEGLVELLNRVQSSRADDQRGLLRKEDLVLPDFLQLPVQ
QPSLPEEQPHGEAPQSPPPQTEPPPPAQGDPAESSASPAL
Download sequence
Identical sequences G3WQD0
ENSSHAP00000017635 ENSSHAP00000017635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]