SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WR68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WR68
Domain Number 1 Region: 306-407
Classification Level Classification E-value
Superfamily ARID-like 4.71e-33
Family ARID domain 0.0004
Further Details:      
 
Domain Number 2 Region: 561-675
Classification Level Classification E-value
Superfamily Chromo domain-like 9.61e-16
Family Chromo barrel domain 0.012
Further Details:      
 
Domain Number 3 Region: 59-114
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000602
Family Tudor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WR68
Sequence length 1315
Comment (tr|G3WR68|G3WR68_SARHA) AT-rich interaction domain 4B {ECO:0000313|Ensembl:ENSSHAP00000017923} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=ARID4B OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MKAIDEPPYLTVGTDVSAKYRGAFCEAKIKTTKRLVKVKVTFRHDSSTMEVQDDHIKGPL
KVGAIVEVKNPDGAYQEAVINKLTDASWYTVAVFDDGDEKTLRRSSLCLKGERHFAESET
LDQLPLTNPEHFGTPVIGKKTNRGRRSNHIPEEESSSSSSDEDEDDRKQIDELLGKVVCV
DYISLDKKKALWFPALVVCPDCSDDIAVKKDNILVRSFKDGKFTSVPRKDVHEISSESSP
KPDAVLKQAFDHALEFHKSKTVPNNWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEE
EEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESG
AVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKMVNKPCKE
CENAKETKNKEEPESEIKAEVKEEGDNILQEEKPAEDEIERKENIKPCLGNKKNLSEPTH
TQSDQEKELNNKKTEENENLEVKEDETIKVDEMLNTKVEAEDEKAKSGDETNKEEDEDEE
EAEEEEEEEEEEEEEEEDDDDDNNEQEEFECYPPGMKVQVRYGRGKNQKMYEASIKDSDV
EGGEVLYLVHYCGWNVRYDEWIKADKIVRPADKNVPKIKHRKKIKNKVDKEKEKDEKYSP
KNCKLRRLSKSPFPANTPPEIASKLDTETKNSEQLQVKSVEITSILNGLQASESSAEDSE
QEDEARTQDIDNNGKEESKADTVSHDKNELSPKEEQSSLSVPQENRIPTDSLISKSISKS
PERLRKDLEDISEDTDYEDEVTIKRKEIKKETTDKASKPQVKRGKRRHCNTEECLKPGSP
SRKEEKSKSKESLCLENSSNSSSDDDEDKSKAKVTPTKKYNGLEDKRKNLRTTGFYSGFS
EVAEKRIKLLNNSDERLQNSRAKDRKDVWSSIQGQWPKKTLKELFSDSDTEAAASPPHAS
SEDVATEEQLQTVAEEENGSLGIELEKPLPVNLDIKPVEEKNIEVNDKKSEFPSSGSNSV
LNTPPTTPESPSSVTVTETSRQQSTVTVSETLAPNQEEVRSIKSETDSTIEVDSVAGELQ
DLQSEGNISPTGFDASVSSSSSNQPELEHPGKVCTGQKRVKDAQGGGSSSKKQKRSHKTS
VVNNKKKGKTTNSSDSEELSAGESVTKSQPAKSVTTGVKSHNTKSPARTQSPGKCNGKNG
DKDSELKEHSNRLPKVYKWSFQMSDLENMTSAERIAILQEKLQEIRKHYLSLKSEVASID
RRRKRLKKKERESAATSSSSSSSPSSSSITAAVMLTLAEPSMSSASQPGMSVECR
Download sequence
Identical sequences G3WR68
ENSSHAP00000017923 ENSSHAP00000017923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]