SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WSN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WSN2
Domain Number 1 Region: 3-282
Classification Level Classification E-value
Superfamily Kelch motif 6.54e-47
Family Kelch motif 0.0044
Further Details:      
 
Domain Number 2 Region: 421-565
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-23
Family C-type lectin domain 0.0032
Further Details:      
 
Domain Number 3 Region: 699-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000314
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WSN2
Sequence length 1065
Comment (tr|G3WSN2|G3WSN2_SARHA) Attractin {ECO:0000313|Ensembl:ENSSHAP00000018437} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=ATRN OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
SLLYRYDLDAGEWLPLNQTVNDVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNELRVFHI
KNESWVLLAPKAKEQYAVVGHSAHIVTMKNGRVVMLVIFGHCPLYGYISNVQEYDIGKNT
WSILQTQGALVQGGYGHSSVYDAKTNSLYIHGGYKAFSANKYRLADDLYKYDVDTQMWTI
LKDSRFFRYLHTAVIISGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLRRP
DLHHDVNRFGHSAVLYNSTMYVFGGFNSLLLSDILMYTAERCEAHQSEDTCVAAGPEVRC
VWNMNSSQCIPWELATEMQEEKTRAECFSKRTADHDKCDQHTDCYSCTANTNDCQWCNDH
CISMNSNCTEGQVSISKYENCPKDNPMYYCNKKTSCKSCAMDQNCQWEPRNQECVALPAQ
ENICGAGWHLVGNSCLKITTTKDNYDNAKLACRNMNAFLASLTTPKKVEFVLKQLRLMQS
AQSLSKTTLTPWVGLRKINVSYWCWEDMSPFTNSLLQWLPSEPSDAGFCGILSEPNARGL
KAATCISSLNGSICERPANHSAKQCRTPCALRTMCGECTSGSSECMWCSNMKQCVDSNAY
VASFPFGQCMEWYTMSSCPPENCSGYCTCGHCLEQPGCGWCTDPSNTGKGKCIEGSFKGP
VKMPFQAATGSHYPQPLLNSSMCLEDNRYNWSFIQCPACQCNGHSKCVNESICEKCENLT
TGKHCETCISGFYGDPTNGGTCQPCKCNGHASLCNTNSGKCFCTTKGIKGDECQLCEVEN
RYQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPEEQNRDLDMFINASKNFN
LNITWATSFTAGTQAGEEMAVVSKTNIKEYKDSFSNEKFDFRSHPNITFFVYVSNFTWPI
KIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMA
SRPFASINVALETDEEPPDLIGGSIKAVPKPIALEPCFGNRAAVLSVFVRLPRGLGGIPP
PGQSGLAVASALVDISQQMPIAYKEKSGAMRNRKQQPPAQPGTCI
Download sequence
Identical sequences G3WSN2
ENSSHAP00000018437 ENSSHAP00000018437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]