SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WTC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WTC7
Domain Number 1 Region: 413-506
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.44e-24
Family Tudor domain 0.0000053
Further Details:      
 
Domain Number 2 Region: 199-279
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.11e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000869
Further Details:      
 
Domain Number 3 Region: 127-198
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.72e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WTC7
Sequence length 646
Comment (tr|G3WTC7|G3WTC7_SARHA) Tudor and KH domain containing {ECO:0000313|Ensembl:ENSSHAP00000018682} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=TDRKH OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MGAFLNPRQDAVPNLMKLPGSPWLIKSGPRGLSPHKTGSSGPRTHTPETQGNARRNFKPS
MLHIGHGSRMQVRTSEKMSTEWSSWTNLSTIQKIALGLGIPASLTVAYILYRRYRESREE
RLTFVGEDDIEVEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDVDTEDVGEERVLLISG
FPVQVCKAKAAIHQILTENTPVYEQLSVPQRSVGRIIGRGGETIRAICKSSGAKITCDKE
SEGTLLLTRLIKISGTQKEVAAAKHLILEKVSEDEELRKRIAHSAESRVQRKQPISVKRE
EVAGPGGAGEPAFPKDMGTGKKLAPSLAATPSRGGGDTAGLRPERVEHSHEKKLSDNSHQ
EDMGAQASPEMPKFEIPSPDFSFHADEYLEVYVSASENPNHFWIQIIGSRSLQLDKLVNE
MTQYYENSQSPEDLTVHVGDIVAAPLPTDGPWYRARVLGTLENGNLDLYFVDFGDNGESP
LKDLRAIRSDFLSLPFQAIECSLARIVPSGEQWEEEALDEFDHLTHCAEWKPLVAKISSY
VQTGISTWPEIHLYDTSNGQNLDIGLELVRQGYAVELPQDVGEGDAAVPEMLQDILATET
DASLDSLLSEAKKSPGETPHTLSCLSLSEAASVSGDDGVLAEDDLL
Download sequence
Identical sequences G3WTC7
ENSSHAP00000018682 ENSSHAP00000018682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]