SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WTJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WTJ9
Domain Number 1 Region: 79-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.92e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 136-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000542
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 3 Region: 237-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000209
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WTJ9
Sequence length 439
Comment (tr|G3WTJ9|G3WTJ9_SARHA) Fibulin 7 {ECO:0000313|Ensembl:ENSSHAP00000018754} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=FBLN7 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MISGSQCALFFFLSFIACQGSPASQNCLNKQQLLSAIRQMQQLLKGQETRFTEGIRNMKN
RLTMLQNSVNKALPDVPAVSCPALEAPHNGRKFGSKYLVDHEVHFTCNPGFQLIGHSSLL
CQSNGNWTGDKPECKDISECASHPCQNGGTCVEGVNQYKCTCPQGWNGNNCQHQAQTAAP
EWSVTNDPAFSRKPRCAKVDRTQHCSCEAGFHMKGTADNSICQDVNECEVYKLEGANQLC
MHNCINTPGSFRCSCPTGYRTLEDGKSCEDIDECADSQNTCTRGTTCINTGGSFQCVNPE
CPKSSGNVSYVKTSSFQCERNPCPMDSKSCHHAPKTISFHYLALPSSLKTPITLFRMATA
SAPGRPGPDSLRFGIVGGNSRGHFVMQRSDRQTGELILVQSLKGPQTLEVDVDMSEYLDR
TFQANHLSKITVFVSPYDF
Download sequence
Identical sequences G3WTJ9
ENSSHAP00000018754 ENSSHAP00000018754 XP_012395552.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]