SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WTK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WTK9
Domain Number 1 Region: 572-737
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-33
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 303-377
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-16
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 393-450
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000113
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Domain Number 4 Region: 2-60
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000137
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 5 Region: 87-138
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000443
Family B-box zinc-binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WTK9
Sequence length 739
Comment (tr|G3WTK9|G3WTK9_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000018764} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
LQDLQSEITCSICRGYFCEPVTIGCGHSFCQACLSSSWRVGAPVFSCPECSREIPLVNMR
LVELTELGKELSSKILQSTEGQSQYVTHKKFCKLLCDEDQTALCVTCWETPDHGAHKISP
VQEAAHKYRRELEHIQTCLGKHLEEDEQLLAQVKRPAVDWYWLIRAEFYQLCRLLMEEEN
RCLDRIRQEQKASQDRLSQHMQSLHDLMQELQEVGHQANMDMLQHARQLLGRSESILAQR
AKAVTPELKSIYRSATNSQMVQLCPKIKVIQLYWSFFNSIIRREVSSSGCCRLEAIGKRR
MAVTGEVVKELQSEITCSICRSYFCEPATIGCGHSFCQACLSSSWRVGAPVFSCPECRQV
SQGREIPLVNRRLAELTRLTKELSSKLMQSTEGQSQCVTHKKPFKLFCEEDQTALCVTCC
ETPEHGAHNISPLQEAAHKYRRELQNIQSHVGKHLKEDEELLVQEEKHAMHWYWMIIEQY
CQTHFFLMEKESQFLESLKEEEKASQNRVSQHMQRLQDLIQELKEAGHQANLDLLQDANQ
LLERSKALLAQRVKPVTPELREYPIPGLIEMLNISENLKSAKAGAGWQLERKSPKDYAHR
YVFAEQAFSSGKKYWEVDVTQLPQWILGIYTRYLRRKRVRNEDSCASVFLLQCVKKKEYY
YLQTYPGALDNQMKGPLPRVGVYLEYSSGTLGFYNVLQSSVIYKFHSIPFTAPVKPIFSP
GPPLPGTKPGPMTVCPVDS
Download sequence
Identical sequences G3WTK9
ENSSHAP00000018764 ENSSHAP00000018764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]