SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WTS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WTS8
Domain Number 1 Region: 267-506
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-62
Family Nuclear receptor ligand-binding domain 0.000000337
Further Details:      
 
Domain Number 2 Region: 25-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.44e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WTS8
Sequence length 517
Comment (tr|G3WTS8|G3WTS8_SARHA) RAR related orphan receptor C {ECO:0000313|Ensembl:ENSSHAP00000018833} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=RORC OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
GGGRTGGLSVHLLQPLPLHRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNV
AYSCTRQQSCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQ
QQQQQQQQQRQVTTPPPAGTRGADTPAYALALPSGQLPLGSSPDLPEASACPPALLGTPG
PGPSYPSSLAKMGLAGDVYSKGYSPDRAKAEVGRAFYGLGSQLSPDRCELHIGEPRHLVL
GEPSQGRDLYSSPSFRLELPNASLTEIEHLVQNVCKSYQETCQLRLEDLQRQRCNVFSRE
EVTNYQRKPKSMWEMWERCAHRLTEAIQYVVEFAKRLEGFMELCQNDQIVLLKAGAMEVV
LVRMCRAYNADNRTVFFEGKYGGMDLFRALGCSELIGSIFDFSHSLCALHFSEDEIALYT
ALVLINANRPWLQEKRKVERLQHNLELAFHHLLCKTHRQGILAKLPPKGKLRSLCSQHME
KLQSFQHLHPVVVQAAFPPLYKELFSTETEPPGVLSD
Download sequence
Identical sequences G3WTS8
ENSSHAP00000018833 ENSSHAP00000018833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]