SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WTY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WTY7
Domain Number 1 Region: 56-146
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.5e-17
Family PWWP domain 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WTY7
Sequence length 263
Comment (tr|G3WTY7|G3WTY7_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000018892} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MRPHGGRFVSILIVSHLLITTFQTFFVLCRGTRHTWVVSTAPNLEIDEMPEAAVKSTANK
YQVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQPSQ
KKGCPEDAEPDREVSEGDGEKKGNTDGSSDEEGKLVIDEPSKEKNEKGALKRRAGDSLED
SPKRLKETQDPEGEGDEKEELALEGERALPTEGEKNSAPSEPGPGRGLVEEEEEEEEDDE
EEEEEETAKEEGPTQGVRDHKSL
Download sequence
Identical sequences G3WTY7
ENSSHAP00000018892 ENSSHAP00000018892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]