SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WUE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WUE4
Domain Number 1 Region: 63-574
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.77e-192
Family Myeloperoxidase-like 0.0000000000000197
Further Details:      
 
Domain Number 2 Region: 23-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family EGF-type module 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WUE4
Sequence length 609
Comment (tr|G3WUE4|G3WUE4_SARHA) Prostaglandin-endoperoxide synthase 2 {ECO:0000313|Ensembl:ENSSHAP00000019049} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=PTGS2 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MMKRIAFLFIFSTAALALSQAANPCCSNPCQNRGICMTTGIDRYQCDCTRTGFYGENCTT
PEFLTRIKLMLKPTPDTVHYILTHFKSVWNIVNNIPFLRDFVMRYVLTSRSNLIESPPTY
NVHYGYKSWEAFSNLSYYTRALPPVRDDCPTPMGVKGKKQLPESKEVVEKCLLRRKFIPD
PQGTNMMFAFFAQHFTHQFFKTDHHRGPAFTKALGHGVDLNHIYGENLERQYKLRLFKDG
KMKYQVIDGEVYPPLVKDTQAEMIYPPHVPEHLKFAVGQEVFGLVPGLMMYATIWLREHN
RVCDILKQEHPEWDDEQLFQTSRLILIEIGETIKIVIEDYVQHLSGYYFKLKFDPELLFS
QSFQYQNRIAAEFNTLYHWHPLLPDTFQIEDKEYSYQQFLYNNSVLVEHGISHMVESFSR
QIAGRVAGGKNVPLAVKKVSIASIDQSRQMKYQSLNEYRKRFMLKPFSSFEELTGEKEMA
AELEALYGDIDAMELYPALLVEKPRPGAIFGETMVELGAPFSLKGLMGNPICSPDYWKPS
TFGGDVGFEIINTASIQSLICNNVKGCPFTAFSVQDSQLKTATINASSSNSGLDDINPTV
LLKERSTEL
Download sequence
Identical sequences G3WUE4
ENSSHAP00000019049 ENSSHAP00000019049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]