SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WUL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WUL9
Domain Number 1 Region: 390-520
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 325-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000931
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 285-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WUL9
Sequence length 691
Comment (tr|G3WUL9|G3WUL9_SARHA) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=DLL4 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MAAASGKLSHWALLLLAAFWQQQRAAGSGVFQLQLREFANEQGVLASGRPCEPHCRTFFR
ICLKHFQAVLSPGPCTFGNVSTPVLGTNSFAVGEESRGGGRNPLQLPFNFTWPGTFSLII
EAWHAPGDNLPPEALPTDTLISTMAIQRPLTVGKNWSSDEQSGPLTRLRYSYRVICSDNY
YGDSCSRLCRSRDDHFGHYVCQADGSLSCLPGWTGEYCDQPICLSGCTEQNGYCNKPGEC
LCRPGWQGRLCDKCIPHNGCRHGTCTIPWQCTCDEGWGGLFCDQDLNYCTHHSPCRNGGT
CSNSGQRGYTCTCRPGFTGVDCEDEIRECDSNPCRNGGSCKDQEDGYHCLCPPSYYGPHC
EHSILSCADSPCFNGGSCREQEHGASYACECPPSFTGSNCEKKVDRCTSNPCANGAQCLE
WGPTRACRCRPGFTGPHCEININDCARNPCAHGGTCHDFVNAYVCTCPPGFSGRNCELRT
VGNACVSGPCLNGGTCYNGLSSDSFVCNCPYDFMGSRCEFLVHSPAQVVQQSSSFPWVAV
SLGVGLVAILVLLGMVAVAVRQLRLRRPEASGREAMNNLSDFQKDNLIPATQLKNTNQKK
ELEVDCDVDKSNCSKQQKHTDYNLAPGPLGRGVTLGKYPPNDKSLGEKAPLRLHSEKPEC
RISAICSPRDSMYQSVCLISEERNECVIATE
Download sequence
Identical sequences G3WUL9
ENSSHAP00000019124 ENSSHAP00000019124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]