SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WUX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WUX8
Domain Number 1 Region: 311-463
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.95e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000404
Further Details:      
 
Domain Number 2 Region: 151-309
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.01e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000557
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 67-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000002
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WUX8
Sequence length 471
Comment (tr|G3WUX8|G3WUX8_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000019233} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MQGPRLLQTLGRLLLSLSVVLAASGEDCDPSLCLNGGTCLNGSESSTFYCLCPDGFTGQN
CQETEQGPCIPNPCQNNGLCRVVTESRRGDVFAQYVCDCPEGYEGPHCQRASESSDLLVE
FLYLTRVPNQEEGYICKCPSPFMGKSCQSRCNMPLGMEGGAIADFQISASSVHYSFLGMQ
RWGPELARLNAKGIVNAWTASNYDKNPWIQVNLLRKMRITGIMTQGASRTGSAEYLRTFK
VAYSNDGQVFEFIQDPNLHRDQVFVGNIDNNGQKTNVFDPPLVAQYVRIAPVVCRRACTL
RFELFGCEVEGCSEPLGMKSEIIPDSKITASSTFKTFGLDAFSWHPYYARLDKQGKFNAW
TAQSKEDTEWLQIDLGTPKKVTGVITQGARDFGNIQYVSAYKVAYSNDGKSWTVYRDSRT
NSNKVFLGNSDNYSHQKNMFKTPFYSRFVRILPVAWHGRITLRRVLHRGGM
Download sequence
Identical sequences G3WUX8
ENSSHAP00000019233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]