SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WUX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WUX9
Domain Number 1 Region: 313-466
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.48e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000397
Further Details:      
 
Domain Number 2 Region: 153-311
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.17e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000557
Further Details:      
 
Domain Number 3 Region: 115-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000101
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 4 Region: 26-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000106
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 67-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WUX9
Sequence length 487
Comment (tr|G3WUX9|G3WUX9_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000019234} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MQGPRLLQTLGRLLLSLSVVLAASGEDCDPSLCLNGGTCLNGSESSTFYCLCPDGFTGQN
CQETEQGPCIPNPCQNNGLCRVVTESRRGDVFAQYVCDCPEGYEGPHCQRASESMNECST
QPCKNGGTCFDQEEGYICKCPSPFMGKSCQSRCNMPLGMEGGAIADFQISASSVHYSFLG
MQRWGPELARLNAKGIVNAWTASNYDKNPWIQVNLLRKMRITGIMTQGASRTGSAEYLRT
FKVAYSNDGQVFEFIQDPNLHRDQVFVGNIDNNGQKTNVFDPPLVAQYVRIAPVVCRRAC
TLRFELFGCEVEGCSEPLGMKSEIIPDSKITASSTFKTFGLDAFSWHPYYARLDKQGKFN
AWTAQSKEDTEWLQIDLGTPKKVTGVITQGARDFGNIQYVSAYKVAYSNDGKSWTVYRDS
RTNSNKVFLGNSDNYSHQKNMFKTPFYSRFVRILPVAWHGRITLRVXXXXXXXXXXXXXX
XXXXXXX
Download sequence
Identical sequences G3WUX9
ENSSHAP00000019234 ENSSHAP00000019234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]