SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WW74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WW74
Domain Number 1 Region: 54-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000238
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3WW74
Sequence length 147
Comment (tr|G3WW74|G3WW74_SARHA) Epithelial mitogen {ECO:0000313|Ensembl:ENSSHAP00000019679} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=EPGN OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MALGIPLYILLNAMVSLSKEAAVTVTTPITSQQSNWTVNKTEAEYTEGPIALKFSHPCLA
DHHSYCINGVCAFHHELRKAICRCTTGYTGERCEHLTLTSYAVDSYEKYIAVGIGVGLLL
SLFLAIIYCYVRKRYGSRRNMAWTALH
Download sequence
Identical sequences G3WW74
ENSSHAP00000019679 ENSSHAP00000019679 XP_003772888.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]