SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WWV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WWV2
Domain Number 1 Region: 45-155
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.14e-34
Family MBT repeat 0.00043
Further Details:      
 
Domain Number 2 Region: 405-510
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.9e-30
Family MBT repeat 0.00088
Further Details:      
 
Domain Number 3 Region: 289-396
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.15e-29
Family MBT repeat 0.00086
Further Details:      
 
Domain Number 4 Region: 181-296
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.41e-27
Family MBT repeat 0.000000845
Further Details:      
 
Domain Number 5 Region: 817-889
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.47e-17
Family SAM (sterile alpha motif) domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WWV2
Sequence length 894
Comment (tr|G3WWV2|G3WWV2_SARHA) Scm like with four mbt domains 2 {ECO:0000313|Ensembl:ENSSHAP00000019907} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=SFMBT2 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MESRVSLVSNMQETSHLSLEKCNSPANGNNEYDSDEGSSMEDPDFNWGEYLEETGAVAAP
HTSFKHVEISLQSSFQPGMKLEVANKNNPDTYWVATIITTCGQLLLLRYCGYGEDRKADF
WCDVMTAELHPVGWCTQNNKVLMPPDAIKEKYTDWTDFLIHDLTGSRTAPANLLEGPLRG
KNPVDLITVDSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLEETESYDQWLFYLDYR
LRPVGWCQENKYRMDPPSEIYSLKTTSEWKCALEKSLNDAAKFPLPMEVFKDHADLRSHF
FTVGMKLEAVDMSEPFNICPASVTKVFNNHYLQVTIDDLRPEAKKISMLCHADSLGILPV
QWCLKNGVNLTPPKGYAGQDFDWADYQKQHGAEAAPHFCFRNTSFSRGFTKNMKLEVVNP
RNPGELCVASVVSVKGKLMWLHLEGLQSPVPEYIVDVESMDIFPVGWCEANAYPLTPPHK
AVLQKKRKIAVVQPEKQLPSTVPVEKIPHDLFSFPQPDTTGTVNGKYCCPQLFINHRCFS
GPYLNKGRIAELPQSVGPGKCVLVLKEVLSMVINAAYKPGRVLRELQLVEDPQWNFQEET
LKAKYRGKTYRAVVKIVRTSDQVADFCKRVCAKLECCPNLFSPVLVTEICPENCSIHTKT
KYTYYYGKRRKIIKPPIGENSTEIGPPKPTRRRKRRKSIFVQKKRRSSTVDFTTGSAEES
EEEDADAMEEDTGSEETSSELRDDQTDTSSADVPSARPRRAVTLRSSTELDRPPPVERTR
RSRKAQTFSCAEGDKCPQAKPDRAEEVKHEEEEKLVLESNPLEWTVTDVVRFIKLTDCAP
LAKIFQEQDIDGQALLLLTLPTVQECMELKLGPAIKLCHQIERVKVAFYAQYAN
Download sequence
Identical sequences G3WWV2
ENSSHAP00000019907 XP_003771452.1.9362 ENSSHAP00000019907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]