SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WWV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WWV7
Domain Number 1 Region: 59-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000101
Family EGF-type module 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WWV7
Sequence length 165
Comment (tr|G3WWV7|G3WWV7_SARHA) Epiregulin {ECO:0000313|Ensembl:ENSSHAP00000019912} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=EREG OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MDSYFWKISTVLLTIGMSLLQNAHSTTVIPTCIPEESNDNCTALVQIENNPPVGPVAIAK
CGEDMQGFCFHGQCIYLVDMSQHVCRCEVGYTGSRCEHFLLTVHQPLSKEYVVLTVMLVI
LFLIIIVGGTYYFLRWYKNRKSKESKKEYERVTLNDEKNSTFLQV
Download sequence
Identical sequences G3WWV7
ENSSHAP00000019912 ENSSHAP00000019912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]