SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WWV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WWV8
Domain Number 1 Region: 56-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000738
Family EGF-type module 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WWV8
Sequence length 162
Comment (tr|G3WWV8|G3WWV8_SARHA) Epiregulin {ECO:0000313|Ensembl:ENSSHAP00000019913} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=EREG OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
LLRSYYLTLLCTGMSLLQNAHSTTVIPTCIPEESNDNCTALVQIENNPPVGPVAIAKCGE
DMQGFCFHGQCIYLVDMSQHVCRCEVGYTGSRCEHFLLTVHQPLSKEYVVLTVMLVILFL
IIIVGGTYYFLRWYKNRKSKESKKEYERVTLNDEKNSTFLQV
Download sequence
Identical sequences G3WWV8
ENSSHAP00000019913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]