SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WWW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WWW0
Domain Number 1 Region: 504-596
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.16e-20
Family Tudor domain 0.0041
Further Details:      
 
Domain Number 2 Region: 787-880
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.73e-20
Family Tudor domain 0.0029
Further Details:      
 
Domain Number 3 Region: 1006-1097
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.03e-18
Family Tudor domain 0.0059
Further Details:      
 
Domain Number 4 Region: 1568-1642
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.73e-16
Family Tudor domain 0.0074
Further Details:      
 
Domain Number 5 Region: 296-374
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000384
Family Tudor domain 0.0063
Further Details:      
 
Domain Number 6 Region: 1306-1399
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000827
Family Tudor domain 0.008
Further Details:      
 
Domain Number 7 Region: 41-134
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000609
Family Tudor domain 0.016
Further Details:      
 
Domain Number 8 Region: 1477-1487
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000628
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WWW0
Sequence length 2102
Comment (tr|G3WWW0|G3WWW0_SARHA) Tudor domain containing 6 {ECO:0000313|Ensembl:ENSSHAP00000019915} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=TDRD6 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MCSTPGLPSPGAPITLRVSFVDVHPEVIPVQLWGLVGDRREEYVRLGHDIQMAAAAVAAR
TRVMSAASPGELCLVQLGPRWHRCRVVSRQAQECRVFLLDEGRTVTANSAALAPGRNEFF
HLPSEVLGCVLTGLVPLGGGGGGEPQQWSRGAVDFLGHLQGKEIQGRVQDVLLPQRLVLL
EVPTVFQQMQDLGLARQVPDSLFRSLLKRYINAAGASVLLPRALPKQEPPQLLDYFYPQL
QLGVTEPVVVTQVCHPHRIHCQLRSLSQEIRRLSDSMAHAYRATGTGDESGRSSSWEERE
ENPDKPGSPCAACGLDGQWYRAQLLENFRPQRCAQVLHVDYGRKELVSCGSLRYLLPEYF
RMPVVTYPCALYGLWDGGRGWSRSQVGDLKALILGQAVNAKIEFYSSFEHVYYVTLYGED
GINLNCAFGVQACCLADRLLQSPGLEEEDGKEESDTEEGMEDDLSSPALKTVRLKANSFY
DAQVEFVKDPSEFWIRLRKHIGPFGKLVRSMCNFYSSRKVDGLALQPVPDHLCCAKWKEH
GYYRAVVTRLVGDKSVEVHLVDRGNTETVGFYDVKMLLPQFRQLPAVALKCCLADIWPLG
ESWSREAISYFKKTVLHKELVIHVLDKQDSQYVIEILDESRMGEENVSKLIAQAGYAKYQ
EFEMTDIRPPTHSPGQIPHQLSADCNRMSSAKKVGIGQWGKKDDKPPVSEVVTDRTIVTK
SSFNESVVQATEKTRNMPIYSPLVQNYLEIKPASPCKGQLEVGSTVEVKVSYVESPGYFW
CQLTRNLQGLRTLMCKIQDFCKNSATPYQGISPACLAKRTINGKWSRALIINGTPSADNA
KVIFVDYGNKEVVPMKNICSINDEFIKLKAQAFRCSLYNLIQPAGQNPFVWDERAIRAFK
EFVDNAWEDNLELKCTIFALAAINNKELFNVVDLLTPFQSACRYLTEIGFARQVRLQKPL
ASSMQLHSYYYSTHDIKIGSEEAVFVTHVDGPWTFYCQLARSSGVLEQLSSDICRLSKVL
QHSKTSSASPGILCLAKYSDQNWYRGIVTGKEPNKVFFVDFGNVHVVTNEDLLPIPGDAY
DLLLLPMQAVKCSLSDVYDNTPKEIAGWFEEAVLDKSLKALVVAKDPDGRLIIELYDGSV
QINAKINEKLGLLGYKGPKKLENEELLSSAETLKEVKNENRKLLAGHSSKTANKLCTSEI
QGESCKPKISLACKELKNLQSSTKVGLLTHYQESVGNQHNQVSHLPDKIENPVQPSAHVS
ERNKDLLLKFCDLPQKSIVPGFKTKVYVSHINDLTDFYIQLADDEDELASISEKLNDDKI
RGECFAGQPLKKGDLICAVFPEDDLRYRAVVKEQSGDLVTVQFIDYGNTSVVNVSKLSRL
QKVNALVPGMSIHCTLGGLHILPTKNQCQELYFSERTGEAQINCEFVMKSEDKWDVLLTD
EQGVISEDMISKFISSSKSTSTQLNTATNPETLSDPPPPPPPPPPPPLRLPPLPLIPLPL
PPEESGDPGKTNVKLLNWYLPEVNKIKVYATVIDGPEYFWCQFADTKVLDCLDPQVQAAG
EHAAVCADCISVIQSGVVCIVKYSEDGRFYRGLVTDVLDGDLISVRLVDFGNAVNFGRNA
LWNIPGNLLNVNMQCFPCCLSGYNVLEGVCSFEENDYFYEIATEGVLELTILEIKKDVCD
IPLAVVQLKYEGENLNEKMLKFSSQFRKADKEFPKTSCENKLREADTPMPLNIDGGSKPN
KVAQDGLLFVESPGDIFRASSGLNHDETKPSPVFESEAITAFVPAMGQPSKGNTGDIREK
CSLAETLKFDSNKNLITGLETLLPRIETKEILELNSLEVPFSLEESKEFLELESIELQLS
ITGEEAKEMDLEPPMVQISQGCDSKMTLEQFTAQLSNDSKSEQLELEPPIAPLSLDKETH
PFSKTSQKSQETLCPEDSGEPNHLKPFGRCKMHSKTETAHNLYKEVFTEYKNRLAVESLT
HLLPEEEIKTEENHGNALTDHATAQIENTYTLEGFTIGSKCVVWSSLKNTWSECQILEIA
DEGTKVLNLSNGMEEIVNPENVWNGIPKLNNSPSEGVYQALEKDFYLNSTDDTAIKGTQK
DT
Download sequence
Identical sequences G3WWW0
ENSSHAP00000019915 ENSSHAP00000019915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]