SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WWZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WWZ5
Domain Number 1 Region: 793-846
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000151
Family Laminin-type module 0.00029
Further Details:      
 
Domain Number 2 Region: 250-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000184
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 3 Region: 849-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 4 Region: 900-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 690-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 6 Region: 362-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000781
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 409-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000173
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 306-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WWZ5
Sequence length 1558
Comment (tr|G3WWZ5|G3WWZ5_SARHA) Laminin subunit gamma 3 {ECO:0000313|Ensembl:ENSSHAP00000019950} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=LAMC3 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MDACYDERGRPQRCLPVFENAAFGRQAQVTNTCGSPPEEYCLQMGAPGDTQLCHRCDARH
PDHSHNASYLTDFHSQEESTWWQSQSMAFGVQYPNSVNITLQLGKAYEITYVRLKFHTSR
PESFAIYKRSWAGGPWVPYQYYSASCEKTYGKREDQYLRPGEDERVAFCTDEFSDISPLS
GGNVAFSTLEGRPSAYSFDESPILQEWVTSTDLLISLNRLNTFGDDIFKDPKVLQSYYYA
ITDFSVGGRCKCNGHASECVLDEGGQLVCSCQHNTTGTDCERCLPFYQDRPWARGTAEAA
NECLPCNCSGLSEECFYDWELYRSTGRGGHCRNCRDHTAGPHCEYCQENFYRWDQQQPCQ
PCDCHPAGSLSLQCDNSGTCECKPSVTGWKCDRCLTGFHSLSEGGCRACACNGAGSLGPC
DSRNGRCPCKDKVEGYLCDRCQPGTFNLQPHNPSGCTSCFCYGHSMVCAASTHYGIRYII
SEFHQGAEGWQIRGPGGREKPAQWSQRGIFLEPKGEELWDFVAPEKFLGDQRFSYGQSLS
LTFWVPPGGSLLPVRLKLEGAGLTLFLKPSSPTASQQPGRPEEYLLVFSLQETSEDTNLP
LPAFHFQRLLANLTGLQIEITGPGGRHSTGQMILTEVQLTSAGPGLSPLAPWVEECTCPE
GYMGQFCESCSLGYKRETPLGGPYASCVPCTCNQHGTCDPETGICQCLHHTEGPYCERCT
SGFYGNPFLGHVDDCKPCPCPGQSACTTIPESGEVVCTHCPKGQRGRLCEICDDGFFGDP
LGRSGPRQPCQRCQCNGNVDPNAVGNCNPTTGHCLRCLYNTTGAHCEQCQEGFYGSALAP
HPLDKCTPCSCNSSGSTREQGACDPRTGQCSCLPHVTGRDCSHCSPGFYDLQPERGCRSC
KCHPVGSQENQCHPVTGQCPCLPGVSGVACTHCQPDFFGFSAKGCRACNCSPLGSVTTQC
HENSTCVCKPGFVGYKCDHCKENFFLTAEGSQCQECPICFSLVKKEATKLKATLTMMEQW
LRKSDCDSPWSNYILLGESTRGDAYQGSYLLQGTREAFLEQMEELESSMRAARHQLRAAS
ESVNCAKNSLEKTCIQLEDIEALLLSTEQEVQQASGALRTMVSLVKGSKVPHQLTNWSHL
ASESQALAKSHRDIATKIEAAAQRALLASNTSYTLLWSLVEGTDAQKIQRELEDKYQEVQ
RAQEELRTSTAQAVKEAKSVLTSVQHVSSERARHLAKLSTPEILPLTHLARDLDRKLQDL
EKTVASREQVFTRAAQDLLATSQGEFQKIQPFQQLHDGADAALSLATSSIAKTRVTVRDS
KTLLTDLEEMRKTFPQPKDQASLRRKARIIQDKLIGDTQKKTKQAERMLGNAASVSATAK
KKAKEAELLAKESTKHSKALLRESKQQYRQAVKLANQAQGALRDISRQVMVSKDRRKEME
KIEWVGTGLNKVERSIREARISLEMDIKTLSILLTRLGKLDPYQALASALNETEQKLEPL
RQRLDGQGPLQDKLSLLEQEAEQQELQIQDLESDLKEIQADKQNLEDILHSLPEGCAS
Download sequence
Identical sequences G3WWZ5
ENSSHAP00000019950 ENSSHAP00000019950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]