SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WY46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WY46
Domain Number 1 Region: 903-1033
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-46
Family Regulator of G-protein signaling, RGS 0.00000591
Further Details:      
 
Domain Number 2 Region: 2-124
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-23
Family Synaptotagmin-like (S variant) 0.0017
Further Details:      
 
Domain Number 3 Region: 155-236
Classification Level Classification E-value
Superfamily PDZ domain-like 6.12e-18
Family PDZ domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WY46
Sequence length 1039
Comment (tr|G3WY46|G3WY46_SARHA) Regulator of G protein signaling 3 {ECO:0000313|Ensembl:ENSSHAP00000020351} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=RGS3 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
GQLKLSIDKQDRVLLLYIIEAKDLMIKDSRPCDAYVKVSVVPDNDRKRRQKTQTIPDCKN
PAFHERFFFPIQEADEQKRLLVAVWNRERDSRQNQLIGCMSFGVKSLLAPDKEISGWYYL
LGQDLGLTKHLKVATRRLKKSRVPVIVLVFGGRYEPGKLLKITIPRGRDGFGFTICCDSP
VRVQAVDSGGPAERAGLQQLDTVLQLNEQPVEHWKCVELAHEIRNCPGEIILLVWRIIPQ
IKPGPDGGVLRRASCKSTHDLQSPPNKREKNSGLGTRPEQRRSCHLVCDSSDGLLVGGWE
RYSEVGKRAQHTLPPLSRPSAPPDPNYIILAPLNPGSQLLRPLYQEDSIPEVSSSPVSGT
IEFSILGKKLESIKTAELSQQHSALDNCNKIQYNIINYKIYKFVTVLKKLYLPPLFNQMK
KSMRRPSEILLIVLHLILCDFFFLAQVTLFVYSDLLLFTKEDEPGRCNVLRNPLYLQSIK
LQEGLSEDLKFCVLYLAEKAECLLTLEAYSQEQKKRVCWCLSKNIAKQQQLAAAPQESKQ
YHSQQKKKKKISAREGKIPGTLSSPPKIEPLPCGEVPPSYSLYPRLKSPDGDTPQPTRAL
VKESPTGQARATPTPPPEPHPRPPPRQQEECEGPPDAQNRQHCLDKKEGQKPQAQMRSHL
TLWLPAEECSPLRELAFCDELPPSIKKLRGKALMEDRSGRVSLLANPGSGPRLPAGRFLP
ARRAMVDFSEKDLERERQRQRETERERHRETETQRDRDTERQRHRERETKRRSSSILIGN
GRNSHLSHRRGETVYGTEESKGSREQGENSFTISLELTICFSPCPIPSPASEKRDLSKPG
PLEFHSEMLLSMYRTRSGNLQRRHTMKEAKDMKNRLGIFRRRNDSPGGNVAGKADKGMKS
LKPTSEEALKWGESLEKLLLHKYGLAVFRAFLRTEFSEENLEFWLACEDFKKVKSQSKMA
SKAKKIFSEYIAIQACKEVNLDSYTREHTKDNLQNVTRGCFDLAQKRIYGLMEKDSYPRF
LRSELYLDLINQKKLSPPL
Download sequence
Identical sequences G3WY46
ENSSHAP00000020351 ENSSHAP00000020351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]