SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3X020 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X020
Domain Number 1 Region: 218-256
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000108
Family Tudor domain 0.018
Further Details:      
 
Domain Number 2 Region: 173-198
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000644
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3X020
Sequence length 515
Comment (tr|G3X020|G3X020_SARHA) Zinc finger CCCH-type and G-patch domain containing {ECO:0000313|Ensembl:ENSSHAP00000021025} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=ZGPAT OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MDENSVEASIQTYHVQLQQVELALGAGLDPTEKADLLQLQADLKQLIELTESSLVSIKKS
KLLATLDPSLGLIESAVRDEAEYLAFQNAISEVTGESEIQGAERATSPERGETEPDKSGH
EEEEEEELSGMKVNAPYYSSWGTLEYHNAMIVGTEQTEDGTAGVRVLYLYPTHKSLKPCP
FFLEGKCRFKENCRFSHGQVVAVDELRPFQEPDLSALHTGSACLAKYDDGIWYPARITDV
DSGYYTVKFDSLLLKETVVEGDGIMPPLRSEDSTLSESDGDDVDDSSYAKVMESETLEKG
AWGPACSSSFAGWEAHTRGIGSKLLAQMGYEFGKGLGKNAEGRVEPIHAVVLPKGKSLDH
CAEILQKRTSGKPNLGKPRKSQAKGNGVKGRPPQRNVFDFLNEKLQGKVARVQEERKVQS
LKRSSKELYHASKSTKRSLSVQLFQILEKVEQTQRDIRSIQEALARNIGRHSVATAQLEE
KLAGAQKELKNLRAQEAGLQREQKTAETHKKMTEF
Download sequence
Identical sequences G3X020
ENSSHAP00000021025 ENSSHAP00000021025 XP_003757609.1.9362 XP_012409554.1.9362 XP_012409555.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]