SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3X0I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X0I7
Domain Number 1 Region: 343-531
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.9e-64
Family Regulator of G-protein signaling, RGS 0.00000769
Further Details:      
 
Domain Number 2 Region: 740-969
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-63
Family DBL homology domain (DH-domain) 0.00000000111
Further Details:      
 
Domain Number 3 Region: 973-1103
Classification Level Classification E-value
Superfamily PH domain-like 8.92e-39
Family Pleckstrin-homology domain (PH domain) 0.00000157
Further Details:      
 
Domain Number 4 Region: 33-122
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-22
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3X0I7
Sequence length 1510
Comment (tr|G3X0I7|G3X0I7_SARHA) Rho guanine nucleotide exchange factor 12 {ECO:0000313|Ensembl:ENSSHAP00000021192} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=ARHGEF12 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MSGTQPTITDRHASILTRESPTDKKQKVERSTSHDFDPTGLVQRCVIIQKDDNGFGLTVS
GDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGSYVALTVQGR
PPGSPQIPLADSEVEPAAFGHMSPIMTSPHSPGTSGNTERITSPVLMGEENNVVHNQKVE
ILRKMLQQEQERLQFLQEDYSRTPAQRLLKEIQEAKKHIPQLQEQLSKATGSTQDGAVVL
SSKTSGDSLPLSEVEADSGDGLGRIDYSSGDGSRPNSDIADSPRSGLKERIYLEESPEKS
EMIPDNDTQSNIGSPLIRTAPQIIGAEDDDFGTEHEQINGQCSCFQSIELLRSRPAHLAA
FLHHVVSQFDPATLLCYLYSDLYKQTNSKETRRIFLEFHQFFLDRAAHLKVSVPDEISLD
LEKRRPELIPEDLHRHYVQTMQDKVYPEVQKHLEDFRQKRSMGLTLAESELTKLDAERDR
DRVILEKERACAEQIITKIEELLMTAQAVEEDKSSTMQYVILMYMKHLGVRVKEPRNLEH
KRGRIGFLPKIKQSIKKDREGEEKVKRRGFPSILGPPRRPSRHDSSAIGRAMELQKQRHP
KHLSTPSSVSPEPQDSAKLRQSGISSDAADVMYMPPNPMSSLTSGTSASQDGGKENEMGS
KQIGEGPASGDSTDGTPRTPNTVFDFPAPPLDQLQEEEGEIERFPEHGTPKSFRKLDSIA
FGESQSEDEQFENDLETDPPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLK
VLDQVFYQRVSREGILSSSELRRIFSNLEEILQLHIGLNEQMKAVRKRNETSVIDEIGED
LLIWFSGSGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQLK
DIIPTQMQRLTKYPLLLDNIAKYTERPKEREKVKKAADHCRQILNYVNQAVKEAENKQRL
EDYQRRLDTSNLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDIL
VLLQKQDDRLVLRCHSKILASTADSKHTFSPVIKLNTVLVRQVATDNKALFVISMSDNGA
QIYELVAQTVSEKAVWQDLIGRMALTVKEQSTKPIPLPESPPCEGEREEEEASKLKEESH
DVSTSSLQSPEKQMGAETSLMSKPQSPSSVISGKSEISDLLAERQFEKEQMEETSKESGM
DFQSTIPEPHLPVCEERWALDALRNLGLLKQLLVQQLGLTEKRTPEDWPHFSRFRTSSQG
VQVESPGVSQNVLDHSENNKTSQFGEGHTSLQTRTGQIACYSPRTSIESPVPQDYMELAS
QDSRASNLLVMDHMIMTPEPSSAELEGGPDDSGEHFFDAREAHSDDNPSESDGTERKEEE
ALQLRISGNVLILDGFETVQESSTEEEGVSNLPSVGWAHQQQSVLNPRSDGGGSPFTPEF
LVQQRWRPGEESGFSAQSPSSSADSHSQIMQYIRKIEADLEHLKKVEESYMTLCQRLAGS
ALTEEHSDKS
Download sequence
Identical sequences G3X0I7
ENSSHAP00000021192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]