SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3X0Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X0Q8
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.21e-31
Family PWWP domain 0.00000889
Further Details:      
 
Domain Number 2 Region: 351-430
Classification Level Classification E-value
Superfamily HIV integrase-binding domain 6.54e-30
Family HIV integrase-binding domain 0.00000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3X0Q8
Sequence length 535
Comment (tr|G3X0Q8|G3X0Q8_SARHA) PC4 and SFRS1 interacting protein 1 {ECO:0000313|Ensembl:ENSSHAP00000021263} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=PSIP1 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
YSENKDKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQASTKQPNASSDVETEEKEISTSKE
DTDHEEKTSNEDVTKTMDITTPKAARRGRKRKAEKQVETEEVGMVTAATTATSVSPKVSP
KRGRPSATEVKVPKPRGRPKMVKPPCPSDNDNVTEEDKNKKKGQDEKQPKKQLKKEEEVQ
KEEDKPRKEPDKKEGKKEVEPKRKTTTKTGFVSTSDSEEEGDDQEGEKKKKRKGGRNFQA
AHRRNIIKGQHEKEAADRKRKQEEQMETESQNKDESKKPEVKKVEKKRETSMDSRLQRIH
AEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKS
TMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKEQGKKGPNKKLDKEQTEGS
KTLNGGSDAQDNNQPQHNGESNEDSKDRHEAIMKKKTSSEDREPEKIPKDSTVEN
Download sequence
Identical sequences G3X0Q8
ENSSHAP00000021263 ENSSHAP00000021263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]