SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3X0R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X0R9
Domain Number 1 Region: 303-414
Classification Level Classification E-value
Superfamily ARID-like 3.66e-34
Family ARID domain 0.00032
Further Details:      
 
Domain Number 2 Region: 564-667
Classification Level Classification E-value
Superfamily Chromo domain-like 3.89e-17
Family Chromo barrel domain 0.011
Further Details:      
 
Domain Number 3 Region: 59-113
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000564
Family Tudor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3X0R9
Sequence length 1261
Comment (tr|G3X0R9|G3X0R9_SARHA) AT-rich interaction domain 4A {ECO:0000313|Ensembl:ENSSHAP00000021274} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=ARID4A OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
YQAADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRLVKVKVILKQDNSTQLVQDDQVKGPL
RVGAIVETKTSDGSFQEAIISKLTDASWYTVVFDDGDERTLRRTSLCLKGERHFAESETL
DQLPLTNPEHFGTPVIGKKSNRGRRSSLPVTEDEKEEESSEEEDEDKRRLNDELLGKVVS
VSSSSEKTEWYPALVISPSCNDDIMVKKDQCLVRSFTDSKFYSIARKDIKEVDILSLPES
ELSTKPGLQKASTFLKTKVVPDNWKMDISEILESSSSDDEDGANEESDEEKDKENAKEEE
ETPEEELDPEERDNFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVYHQGGCDNID
SGAVWKQIYMDLGIPILNSAASYNVKTAYRKYLYGFEEYCRSANIQFRTIHHNEPKVIEE
IKKLEESMEETVKVEQEMPLVEVKSEPEENIDSNSESEKEEIELKSPRGRRRIARDLTPA
KKENEEEKTEDKLRDNNKENKDIEEESDIIEKKENEALLGKKNTPKPKEKKIRKQEESDK
DSDEEEEKRREREEIENKEESEGEEDEEDIEPCLTGTKVKVKYGRGKTQKIYEASIKSTE
IDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGGPKRKQKKKTKNKEDSEKDDKKDEE
RQKSKRGRPPLKSTLPSNMSYSVSKSPNIEGKADSASSDSEIEDTSDKNLVNEEFSPEIL
EELEKSEKFIDDKIEEENPKFPCVLKENDRTQVQSLETLKLEVEESEQIVQIFGNKTEQV
EEIKKETEKSPKAKGRKNKIKDLSLETIKISPLSQDEARSESYIEPLSLEVSSLESKDFS
STTEDEMDSCSKEKKLKRKIPGQSSPEKKIRIETEMDVPALVSEERTSDSIISEEFKELN
SEEQPEIEHEEMPSLIAESEPPVQDLATENFDFPNAKESENVAVKEEEEDIMPLIGPETL
VCHEVDLDDLDEKDKNSADEAGTDIPDPVSPVPNPPALPPAAPSGFSAASPLALSQEESR
SIKSESDITIEVDSVAEESQEGLCESESANGFEASTTSSTCSVTVQEREIRDKGQKRQSD
GNGGSLAKKQKRPPKRTSATIKNEKNGAGQSSDSEDLPVPDSTSKCTPVKHIHVAKPPKL
ARSPARMMSPHIKDGDKDKHRDKHQNSSPRAYKWSFQLNELDNMNSTERISFLQEKLQEI
RKYYMSLKSEVATIDRRRKRLKKKDREVSHAGASMSSASSDTGMSPSSSSPPQNVLAVEC
R
Download sequence
Identical sequences G3X0R9
ENSSHAP00000021274 ENSSHAP00000021274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]