SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3X107 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X107
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.01e-17
Family PWWP domain 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3X107
Sequence length 179
Comment (tr|G3X107|G3X107_SARHA) HDGF like 3 {ECO:0000313|Ensembl:ENSSHAP00000021362} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=HDGFL3 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
YPQQIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEG
LWEIENNPRVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGS
KRKKSYTSKKSSKQSRKSPADEDDKDCKEEENKSGSEAGDAGNDTRNTSSDLQKTSEGV
Download sequence
Identical sequences G3X107
ENSSHAP00000021362 ENSSHAP00000021362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]