SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3X286 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X286
Domain Number 1 Region: 230-321
Classification Level Classification E-value
Superfamily PDZ domain-like 1.28e-21
Family PDZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 349-448
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-20
Family PDZ domain 0.0013
Further Details:      
 
Domain Number 3 Region: 121-213
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-20
Family PDZ domain 0.0025
Further Details:      
 
Domain Number 4 Region: 8-87
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-19
Family PDZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3X286
Sequence length 515
Comment (tr|G3X286|G3X286_SARHA) PDZ domain containing 1 {ECO:0000313|Ensembl:ENSSHAP00000021791} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=PDZK1 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MASTITPRECKLSKQDGQSYGFFLRIEKDTEGHLVRVVEQGSPAEKAGLRDGDRVLCING
VYVDKEEHLKVVDLVKKSGNSVTFLVLDGVSYEQAIKKGTSLKELSQSHKESPPVMNGVA
GAGSQPRLCYLVKEGSSYGFSLKTVQGKKGVYMTDLIPQGVASKAGVQSEDRLIEVNGEN
VENASHEEVVEKVKKAGSQIMFLLIDKDMDKYYNDHKIKVKRETASLVLLPHKPRVVDMT
KGRDGYGFYLRVGPGQKGQIIKDIDSGSPAEAAGLKNNDLLVAVNGESVENLDHDSIVEK
IKKGGDQTSLLVVDKETDAIYRLAQFSPFLYYLQNQVLPNGTVKEVPAVPSPMAAGPASS
EKVTYKPKLCRLVKGPQGYGFHLNAVRDQPGSFIKEVQKGSPAALAGLEDDDYIIEVNGV
NVMDEPYEGVVEKIQISGKSVVLLVCAKKAYNYFLAKKIPILSSMADPLEDSPNSTEESP
ATPEKDSPVTKERSFPSAQANSTGSQSSSSEDTEL
Download sequence
Identical sequences G3X286
ENSSHAP00000021791 ENSSHAP00000021791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]