SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3X2I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X2I5
Domain Number 1 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000293
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 2 Region: 411-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000486
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 467-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Laminin-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3X2I5
Sequence length 585
Comment (tr|G3X2I5|G3X2I5_SARHA) Netrin G2 {ECO:0000313|Ensembl:ENSSHAP00000021890} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=NTNG2 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MLLLASLLLHCLPLAMGDYDICKSWVTTDEGPSWEFYACQPKAMSMKDYVTVKVEPAGIT
CGDPPERFCTHENPYLCSDECDASNPDLAHPPRLMFDKEDEGLATYWQSVTWSRYPSPLE
ANITLSWNKSIELTDDIVVTFEYGRPTIMMLEKSLDNGRTWHPYQYYAEDCMEAFNMPPR
RVRDLSSTSANRVVCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNLDNLYTRLESA
KGLKEFFTATDLRMKLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSYKE
GGLQCECEHNTTGQDCGKCKKNFRTRSWRAGSYLPLPNGSPNACAAAGSAFGREWTSSST
AAPLQMGTPMPKVNTKAEAITTVAVPAKISKLFQLKPRSPQVVPIEVFKDCECYGHSNRC
SYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSINDRCN
ETGHCECREGAAGPKCDDCLPSHYWRQGCFPNVCDDEYLLCQNGGTCYQNQRCLCPSGYQ
GVLCDQPLCQGEEGQACDPAPCASPHLAAFLGSGLLLWLAGCLGY
Download sequence
Identical sequences G3X2I5
ENSSHAP00000021890 ENSSHAP00000021890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]