SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3X2I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X2I7
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.52e-16
Family Ovomucoid domain III-like 0.0052
Further Details:      
 
Domain Number 2 Region: 164-228
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000277
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 3 Region: 261-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000449
Family EGF-type module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3X2I7
Sequence length 374
Comment (tr|G3X2I7|G3X2I7_SARHA) Transmembrane protein with EGF like and two follistatin like domains 2 {ECO:0000313|Ensembl:ENSSHAP00000021892} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=TMEFF2 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MVLWESPRQCSSWTLCDGFCWLLLLPVMLLIIARPVKLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGDSVTCVCQFKCNSDYVPVCGSNGDTYQNECYLRQAA
CKQQSEILVASEGSCAADAGSGSGDGVNEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDG
HYARTDFAENPNKLEESARGLYIPCPEHYNGFCLHGKCEHSINMLEPSCRCDAGYTGQHC
EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAIICVVVLCITRKCPRSNRIHRQKQNTGH
YSSDNTTRASTRLI
Download sequence
Identical sequences G3X2I7
ENSSHAP00000021892 XP_003764103.1.9362 ENSSHAP00000021892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]