SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3X6G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X6G8
Domain Number 1 Region: 35-311
Classification Level Classification E-value
Superfamily L domain-like 1.97e-57
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 241-477
Classification Level Classification E-value
Superfamily L domain-like 2.72e-41
Family Ngr ectodomain-like 0.0028
Further Details:      
 
Domain Number 3 Region: 542-850
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.86e-20
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3X6G8
Sequence length 943
Comment (tr|G3X6G8|G3X6G8_BOVIN) Leucine rich repeat containing G protein-coupled receptor 6 {ECO:0000313|Ensembl:ENSBTAP00000006288} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LGR6 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MPRAPRLLPLWLCAAALCAPPAAPPPRPRPGCPVPCRCREAGILLWVDCSERGLSTVPAG
LDPLTAYLDLSMNSLTELWPGVFHHLRFLEELRLSGNRLAHIPGQAFSGLSSLKILMLQN
NRLGGIPAEALWELPGLQSLRLDANLISLVPDRSFEGLTSLRHLWLDDNALTEIPVRALS
HLRALQAVTLALNRIGRVPDYAFWNLSSLVVLHLHNNRIRHLGAHSFEGLQNLETLDLNC
NQLHEFPVAIQTLGRLQELGFHNNNIRAIPEKAFLGNPLLQTIHFYDNPIQFVGRSAFQH
LPGLHTLSLNGATDIQEFPDLRGTTSLESLTLTRAGLQRLPPGMCQQLPRLRVLELSHNL
IEGLPSLRGCQKLEEIGLQHNRIWEVRADTFRELTFLRSLDLSWNAIRSIHPEAFSTLRS
LVKLDLTGNQLSVLPLAGLGGLVHLKLRGNRALSQAFPKDSFPRLSPRTLEVPYAYQCCA
YSGCPGFFTASGLRGPQHPPPDAQDPPKRTLADRAESRYDLDPEELQLEMEEPRPQPAVQ
CSPAPGPFQPCEHLFESWGVRLAVWAVVLLALLCNALVLLSLSVAGPGPLPPAKFVVGAL
AGANALTGLSCGLLASVDALTFGQFAEFGARWEAGPGCRAAGFLAVLGSEASVLLLSLGA
AHCSVAAACVRAHGKAPAAGSVRAGALGCLALAGLLAALPLASVGEYGASPLCLPHAPPA
GRPAALGFAVALVLLHAACLLAAALACIRLSCRLPAAGLEASWDCAAVRHVAWLTFADGL
LYCPVAFLSLASALGLLPVTPEAVKAVLLLVLPLPACLNPLLYLLFSPHSREDLRRLRPC
WGGPREPSSCDSTQALVAFPDVELTAEASETQGLPLGALVPRQQPGGLKLEGGHVAEPEG
TRFGQQPPSRDGGRAQGTPEASLAGRGRAGGGGFQSSGLASGV
Download sequence
Identical sequences G3X6G8
ENSBTAP00000006288 ENSBTAP00000006288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]